KEGG   Saccharomyces cerevisiae (budding yeast): YDR438W
Entry
YDR438W           CDS       T00005                                 

Symbol
THI74
Name
(RefSeq) Thi74p
  KO
K15289  solute carrier family 35, member F5
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Brite
KEGG Orthology (KO) [BR:sce00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:sce02000]
    YDR438W (THI74)
Transporters [BR:sce02000]
 Solute carrier family (SLC)
  SLC35: Nucleoside-sugar transporter
   YDR438W (THI74)
SSDB
Motif
Pfam: EamA CstA
Other DBs
NCBI-GeneID: 852048
NCBI-ProteinID: NP_010726
SGD: S000002846
UniProt: Q04083
Position
IV:1338274..1339386
AA seq 370 aa
MNRVGIDVDHMIGVLLLAVVVVFWVGASCLTNELLETNAYNKPFFLTYLNISSFALYLTP
DLWRIIQSRRKSLQERTERTLPIHTQESFSEFLPLLSSTPSTSSNLSSIADTKVKDTMRL
SLLFCVLWFVANLAANAALSYTTVASSTILSSTSSFFTLFLATSLGIETFSTKKLLGLFV
SLFGIILIVMQSSKQQDSVSASSFLVGNTLALLGSLGYSVYTTLLKYEISSKGLRLDIQM
FLGYVGIFTFLLFWPILIILDITHMETFELPSNFHISFLVMLNCIIIFVSDYFWCKALIL
TSPLVVTVALTFTIPLAMFADFVWREAFFTPWYIIGVIFIFVSFFLVNHRGESAVEKDCA
AVEKGPILDA
NT seq 1113 nt   +upstreamnt  +downstreamnt
atgaatcgtgttggtatagacgtagatcatatgataggggtcctgcttctggccgtagtg
gtggtgttttgggttggcgcttcgtgtttgactaatgaattgctcgagacaaacgcgtac
aataaacctttcttccttacttatctaaacatatcatcgtttgctctttatttgacgcca
gatctatggaggataatccaatcaagaaggaagagcttgcaggaacggacagaacgaaca
ttacctattcacacacaagaatctttttcagagttcctacctttactatcttcaactcct
tctacttcttcaaatttgtcttcgatagcggacacgaaagtgaaggatacaatgaggttg
agtctgctattttgcgtcttgtggttcgtggcaaatttggcggctaacgctgctttgtcg
tataccacagtggcttcgtcaacaattctttcatcgacatcctcattttttaccttattt
cttgccactagtctaggaatagaaactttttcgacaaaaaaactgctggggttatttgtg
tctttgtttggaattatcttaattgtgatgcaatcctcgaagcaacaggattctgtgagt
gcttcctcctttttggtaggtaacactttagcactgctggggtcattgggttacagtgtc
tatacaacccttttgaaatacgaaatatcatccaaaggtctcagactagacattcagatg
tttcttggttatgttggtatcttcacgtttctgttgttttggccaattttaataatcctg
gatataacacatatggaaacttttgaactaccaagtaacttccacatttcttttcttgtc
atgttaaattgtatcattatctttgttagtgactatttttggtgtaaagccctcattttg
acatcacccttggtggttaccgttgccttaacttttactatcccgttagccatgttcgct
gattttgtatggcgagaggcattttttacgccttggtatatcattggtgttattttcatt
tttgtttcattctttctagttaaccatcggggagaatctgctgttgaaaaggactgtgct
gcggttgaaaaaggacctatcttggatgcctaa

DBGET integrated database retrieval system