KEGG   Saccharomyces cerevisiae (budding yeast): YDR452WHelp
Entry
YDR452W           CDS       T00005                                 

Gene name
PPN1, PHM5
Definition
(RefSeq) endopolyphosphatase
  KO
K06018  endopolyphosphatase [EC:3.6.1.10]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Brite
KEGG Orthology (KO) [BR:sce00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    YDR452W (PPN1)
Enzymes [BR:sce01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.10  endopolyphosphatase
     YDR452W (PPN1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Metallophos Endonuc_Holl
Motif
Other DBs
NCBI-GeneID: 852063
NCBI-ProteinID: NP_010740
SGD: S000002860
UniProt: Q04119
Position
IV:1362878..1364902
Genome map
AA seq 674 aa AA seqDB search
MVVVGKSEVRNVSMSRPKKKSLIAILSTCVLFFLVFIIGAKFQYVSVFSKFLDDRGDNES
LQLLNDIEFTRLGLTPREPVIIKDVKTGKERKLHGRFLHITDIHPDPYYVEGSSIDAVCH
TGKPSKKKDVAPKFGKAMSGCDSPVILMEETLRWIKENLRDKIDFVIWTGDNIRHDNDRK
HPRTEAQIFDMNNIVADKMTELFSAGNEEDPRDFDVSVIPSLGNNDVFPHNMFALGPTLQ
TREYYRIWKNFVPQQQQRTFDRSASFLTEVIPGKLAVLSINTLYLFKANPLVDNCNSKKE
PGYQLLLWFGYVLEELRSRGMKVWLSGHVPPIAKNFDQSCYDKFTLWTHEYRDIIIGGLY
GHMNIDHFIPTDGKKARKSLLKAMEQSTRVQQGEDSNEEDEETELNRILDHAMAAKEVFL
MGAKPSNKEAYMNTVRDTYYRKVWNKLERVDEKNVENEKKKKEKKDKKKKKPITRKELIE
RYSIVNIGGSVIPTFNPSFRIWEYNITDIVNDSNFAVSEYKPWDEFFESLNKIMEDSLLE
DEMDSSNIEVGINREKMGEKKNKKKKKNDKTMPIEMPDKYELGPAYVPQLFTPTRFVQFY
ADLEKINQELHNSFVESKDIFRYEIEYTSDEKPYSMDSLTVGSYLDLAGRLYENKPAWEK
YVEWSFASSGYKDD
NT seq 2025 nt NT seq  +upstreamnt  +downstreamnt
atggttgtagtgggtaagagtgaagtgcgcaatgtaagcatgagtaggccgaagaagaaa
tcattgattgccatcctgtcgacctgtgttttgtttttcctcgtgtttataattggtgct
aaatttcaatatgtttccgttttctccaaattcttagatgacaggggggacaacgagtca
cttcaattgctcaatgacatagaatttacaaggctaggactgacacctagggagccagta
attatcaaagacgtaaagacagggaaggagagaaaattacatggacggttccttcatatt
accgatattcatcctgacccttattatgtggaaggaagctctattgatgcagtttgtcac
acaggaaaaccaagcaaaaaaaaggatgtggcacccaagtttgggaaggcaatgtctgga
tgtgattctcccgttattttaatggaagaaactctgagatggattaaagaaaatcttaga
gataagattgattttgtcatttggacgggtgataatatcagacatgacaatgaccggaaa
catccaagaacagaagcacaaatttttgatatgaacaatatcgttgctgataaaatgaca
gaattatttagtgctggcaatgaagaagatccaagagattttgatgtgtctgtcattcca
agtcttggaaacaatgatgtctttccacataacatgtttgcactaggaccaactctacaa
actagagaatattataggatttggaaaaattttgttccgcagcagcagcaaagaactttt
gataggagtgcttcatttttgactgaagttattccagggaagcttgctgtcctgtcaatt
aacacgctgtacttattcaaggccaatccgttagttgacaattgtaattcaaaaaaagaa
ccaggttaccaacttttactttggttcggttatgtattagaagaactaaggagtagggga
atgaaagtatggttaagtggacatgtacctccaatcgcaaaaaatttcgatcagtcgtgc
tacgataagttcacgctatggactcacgaatacagggatataatcattggaggattatac
ggtcacatgaatattgaccacttcatcccaacggatggtaaaaaagctagaaaatcgtta
ttgaaagccatggagcaatccactcgtgttcaacaaggagaagacagtaatgaagaggac
gaagaaactgaattgaatagaattctggatcacgctatggcggcaaaagaagttttttta
atgggagcgaaaccatctaacaaagaagcatatatgaacaccgtccgcgacacatactat
cggaaagtgtggaataagctggaaagagtggatgaaaaaaatgttgaaaatgagaagaaa
aagaaagaaaagaaggacaaaaaaaagaaaaagccaatcactagaaaagagctcattgaa
cgctattccattgtgaacataggtggttcagtcattccaactttcaatccttcctttagg
atctgggaatataacatcaccgacatagtgaatgactccaattttgcagtttcggagtat
aagccctgggatgaatttttcgagtcactaaataagattatggaagactctttgctagaa
gatgaaatggacagcagtaatatcgaggttgggatcaaccgcgagaagatgggcgaaaag
aaaaacaagaagaaaaagaaaaatgacaagactatgccaattgagatgccagacaaatac
gaactcggccctgcatatgtaccgcagttattcactccgacgcgtttcgtccaattctac
gccgacttggaaaaaatcaatcaagaattacataattcatttgttgaatctaaggatatt
ttcaggtatgagatagaatatacctcagacgagaaaccatactcaatggattcgttaaca
gtaggaagttatttggatcttgcaggcagattatacgaaaacaaacctgcatgggaaaaa
tacgtcgaatggtcatttgcgtcttctggatataaagatgattaa

DBGET integrated database retrieval system