KEGG   Saccharomyces cerevisiae (budding yeast): YDR453CHelp
Entry
YDR453C           CDS       T00005                                 

Gene name
TSA2
Definition
(RefSeq) thioredoxin peroxidase TSA2
  KO
K03386  peroxiredoxin (alkyl hydroperoxide reductase subunit C) [EC:1.11.1.15]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Brite
KEGG Orthology (KO) [BR:sce00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sce04147]
    YDR453C (TSA2)
Enzymes [BR:sce01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.15  peroxiredoxin
     YDR453C (TSA2)
Exosome [BR:sce04147]
 Exosomal proteins
  Proteins found in most exosomes
   YDR453C (TSA2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AhpC-TSA Redoxin 1-cysPrx_C SCO1-SenC
Motif
Other DBs
NCBI-GeneID: 852064
NCBI-ProteinID: NP_010741
SGD: S000002861
UniProt: Q04120
Structure
PDB: 

Position
IV:complement(1365072..1365662)
Genome map
AA seq 196 aa AA seqDB search
MVAEVQKQAPPFKKTAVVDGIFEEISLEKYKGKYVVLAFVPLAFSFVCPTEIVAFSDAAK
KFEDQGAQVLFASTDSEYSLLAWTNLPRKDGGLGPVKVPLLADKNHSLSRDYGVLIEKEG
IALRGLFIIDPKGIIRHITINDLSVGRNVNEALRLVEGFQWTDKNGTVLPCNWTPGAATI
KPDVKDSKEYFKNANN
NT seq 591 nt NT seq  +upstreamnt  +downstreamnt
atggtagcagaagttcaaaaacaagccccaccatttaagaaaaccgccgtagtcgacggt
atcttcgaggaaatttcactggaaaagtataaaggtaagtacgttgttctagcttttgtc
ccattggctttttcatttgtctgtccaactgagattgttgcgttttccgatgccgccaag
aaattcgaagatcagggcgcccaagttttatttgcctccaccgactctgaatattcctta
ctggcatggaccaaccttcccagaaaagacggtggattaggtccagttaaagttcctttg
cttgctgataagaatcattccttatccagagactatggcgttttgattgaaaaagaaggt
atagctttaagaggtttgttcataatcgacccgaagggaatcattagacatatcactatc
aatgatttatctgttggcagaaacgtcaatgaagctttgagattagtcgaaggtttccag
tggactgacaaaaatggtacagttttgccatgcaactggaccccaggagccgccaccatc
aaacctgacgttaaagattccaaggagtatttcaaaaatgccaataattaa

DBGET integrated database retrieval system