KEGG   Saccharomyces cerevisiae (budding yeast): YDR454CHelp
Entry
YDR454C           CDS       T00005                                 

Gene name
GUK1, BRA3, PUR5
Definition
(RefSeq) guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce00230  Purine metabolism
sce01100  Metabolic pathways
Module
sce_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:sce00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    YDR454C (GUK1)
Enzymes [BR:sce01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     YDR454C (GUK1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_16 AAA_33 AAA_18 AAA_24 AAA_22 MMR_HSR1 AAA_30 AAA RNA_helicase ABC_tran AAA_28 AAA_14 AAA_29 RsgA_GTPase NACHT AAA_2 DUF2075 Rad17 AAA_7 KRTDAP T2SSE AAA_19 NTPase_1 ATPase_2 Viral_helicase1 dNK Tfb5 KAP_NTPase cobW AAA_5 Parvo_NS1 Adeno_IVa2 MobB Cytidylate_kin AAA_17
Motif
Other DBs
NCBI-GeneID: 852065
NCBI-ProteinID: NP_010742
SGD: S000002862
UniProt: P15454
Structure
PDB: 

Position
IV:complement(1366264..1366827)
Genome map
AA seq 187 aa AA seqDB search
MSRPIVISGPSGTGKSTLLKKLFAEYPDSFGFSVSSTTRTPRAGEVNGKDYNFVSVDEFK
SMIKNNEFIEWAQFSGNYYGSTVASVKQVSKSGKTCILDIDMQGVKSVKAIPELNARFLF
IAPPSVEDLKKRLEGRGTETEESINKRLSAAQAELAYAETGAHDKVIVNDDLDKAYKELK
DFIFAEK
NT seq 564 nt NT seq  +upstreamnt  +downstreamnt
atgtcccgtcctatcgtaatttctggcccaagtggtacaggtaaatctacactgttgaag
aaattgttcgctgaatacccagattctttcgggtttagtgtttcatccactactagaacc
ccaagagctggcgaagtaaacggtaaggactataactttgtctccgtagatgaattcaaa
tctatgattaagaacaatgaattcattgaatgggcgcaattctccggtaactactatggt
agtactgtcgcttccgtcaaacaagtcagtaaatctggtaagacttgtattttagatatt
gatatgcagggtgtcaaatctgtcaaggctatcccagagttaaatgccaggtttttgttt
attgctccaccatcggtcgaggatttgaaaaaaagattagaaggtagaggtacggagacc
gaagaatccatcaacaagaggttaagcgccgctcaagctgaattggcatatgctgagaca
ggtgcccatgacaaagttattgtcaatgatgatttggacaaggcctacaaggaattgaag
gattttatctttgcagaaaaatga

DBGET integrated database retrieval system