KEGG   Saccharomyces cerevisiae (budding yeast): YDR456WHelp
Entry
YDR456W           CDS       T00005                                 

Gene name
NHX1, NHA2, VPL27, VPS44
Definition
(RefSeq) bifunctional K:H/Na:H antiporter NHX1
  KO
K12041  solute carrier family 9 (sodium/hydrogen exchanger), member 6/7
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Brite
KEGG Orthology (KO) [BR:sce00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:sce02000]
    YDR456W (NHX1)
Transporters [BR:sce02000]
 Solute Carrier Family (SLC)
  SLC9: Na+/H+ exchanger
   YDR456W (NHX1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Na_H_Exchanger Myc_target_1
Motif
Other DBs
NCBI-GeneID: 852066
NCBI-ProteinID: NP_010744
SGD: S000002864
UniProt: Q04121
Position
IV:1367485..1369386
Genome map
AA seq 633 aa AA seqDB search
MLSKVLLNIAFKVLLTTAKRAVDPDDDDELLPSPDLPGSDDPIAGDPDVDLNPVTEEMFS
SWALFIMLLLLISALWSSYYLTQKRIRAVHETVLSIFYGMVIGLIIRMSPGHYIQDTVTF
NSSYFFNVLLPPIILNSGYELNQVNFFNNMLSILIFAIPGTFISAVVIGIILYIWTFLGL
ESIDISFADAMSVGATLSATDPVTILSIFNAYKVDPKLYTIIFGESLLNDAISIVMFETC
QKFHGQPATFSSVFEGAGLFLMTFSVSLLIGVLIGILVALLLKHTHIRRYPQIESCLILL
IAYESYFFSNGCHMSGIVSLLFCGITLKHYAYYNMSRRSQITIKYIFQLLARLSENFIFI
YLGLELFTEVELVYKPLLIIVAAISICVARWCAVFPLSQFVNWIYRVKTIRSMSGITGEN
ISVPDEIPYNYQMMTFWAGLRGAVGVALALGIQGEYKFTLLATVLVVVVLTVIIFGGTTA
GMLEVLNIKTGCISEEDTSDDEFDIEAPRAINLLNGSSIQTDLGPYSDNNSPDISIDQFA
VSSNKNLPNNISTTGGNTFGGLNETENTSPNPARSSMDKRNLRDKLGTIFNSDSQWFQNF
DEQVLKPVFLDNVSPSLQDSATQSPADFSSQNH
NT seq 1902 nt NT seq  +upstreamnt  +downstreamnt
atgctatccaaggtattgctgaatatagctttcaaggtgctgttaaccaccgccaagaga
gcagttgatcctgacgatgatgatgaacttctaccttccccggatctcccgggtagcgat
gaccctattgcaggtgatcctgatgtagacttaaaccctgttacagaagaaatgttctct
tcatgggcattgttcattatgttgctcctattgatctctgcattgtggtctagttactat
ttaactcagaaacgaattagggcagtgcatgaaactgtgctttctattttttatggtatg
gttattggcttgataataaggatgtcccccgggcattatattcaagatacggttactttt
aattcatcctacttttttaatgttctattgccgccaattattttaaatagtgggtacgag
ttgaatcaagtgaactttttcaataatatgttatctatcttaattttcgccataccgggc
accttcatatctgctgtggttattggaatcatattgtatatctggacctttttaggacta
gagagtattgacatttcattcgcagatgcaatgtctgttggtgctacattatctgctacc
gaccctgttacaattctttcaattttcaatgcgtataaagtggatcctaagctatatacc
atcatttttggagaatcactgttaaatgatgccatctctattgttatgtttgaaacctgt
caaaaatttcatggtcaacctgcaacattttcgtcggtttttgaaggggcaggcctcttt
ttgatgactttctccgtttcgttgttgataggcgttcttataggaattcttgttgctctt
ctgttgaaacacactcacataaggcgctatcctcaaattgagagttgtttgatcttgttg
attgcttatgaatcctattttttctccaacggttgccatatgtccggtatcgtctccttg
ttattttgcggaattactttaaaacattacgcctattataacatgtcaagaagatcacag
atcaccattaagtatattttccaactattggcaagattatcagagaatttcatctttatc
tatctaggtttagaactttttactgaagtagaactagtctataagccactgctaattatt
gtggcagctatttctatatgtgttgctcgttggtgtgctgtgttcccattgtcgcaattt
gttaactggatatatagagtaaagacaatcagatctatgagcggcataaccggagaaaat
atttctgttcccgatgaaataccctacaattaccaaatgatgacattttgggcaggttta
cgtggtgctgttggtgtcgccttggcgttgggaattcaaggtgagtataagttcacttta
ttggcaacggtccttgttgttgttgttttaacagttatcatttttgggggcactactgca
ggaatgttagaagttttaaatattaagactggttgcataagtgaagaagatacatctgat
gacgagtttgatatagaggctccaagggcgataaatttattgaacggtagttctattcag
acagatttgggcccatattctgacaacaattctccagatatttcaattgaccaattcgcg
gtcagcagtaacaagaatctccccaataacatatccacaactggtggtaatacttttgga
ggccttaatgaaactgagaatactagccctaacccggcaaggtcttctatggataagcgt
aatttgagagataaactgggaacaatctttaattccgactcacaatggtttcaaaatttt
gatgaacaggtattgaagccagtattcttggacaacgtttctccatccttacaagattcg
gctacgcaatcacctgcagatttctcttcccaaaaccactag

DBGET integrated database retrieval system