KEGG   Saccharomyces cerevisiae (budding yeast): YDR457WHelp
Entry
YDR457W           CDS       T00005                                 

Gene name
TOM1
Definition
(RefSeq) E3 ubiquitin-protein ligase TOM1
  KO
K10592  E3 ubiquitin-protein ligase HUWE1 [EC:2.3.2.26]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce04120  Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:sce00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    YDR457W (TOM1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:sce04121]
    YDR457W (TOM1)
Enzymes [BR:sce01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.26  HECT-type E3 ubiquitin transferase
     YDR457W (TOM1)
Ubiquitin system [BR:sce04121]
 Ubiquitin ligases (E3)
  HECT type E3
   YDR457W (TOM1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HECT DUF908 DUF913 UBM
Motif
Other DBs
NCBI-GeneID: 852068
NCBI-ProteinID: NP_010745
SGD: S000002865
UniProt: Q03280
Position
IV:1369790..1379596
Genome map
AA seq 3268 aa AA seqDB search
MVLFTRCEKARKEKLAAGYKPLVDYLIDCDTPTFLERIEAIQEWDRSRDDLYVWIPILDR
MDGLLLKVAEKYKYKQDPKKECEVKLVEMEAHDVDYCLKMLKFTRRLLLNTENRFVYSSG
DVLMYLLNCPNFTIKLAVMRILAILGERFVIAREKIVAHNIFGDHNLRKKTLKLALSLSS
SVMDEDGEHFSLVDLYFDKKKVPQKWRKLRFTHYTSNDFKKSSQQKNNINETQTSIKKVT
MTTQELCEHSLQQIFDKGMALLPAESWFDFSIKASVAKAFSDDSGENIDLRNIIIETKLN
AIAFVNTIFSPPQVSSKLFELDPYAFNSLTDLISLSETKIPKELRTDALFTLECISLKHV
WCSDIIRNLGGNISHGLLFQILRYIAKTLREATDEIDEEYNVRFFYLISNLADVKPLHES
LFAAGLIPTLLEIVSIRNCPYKRTLASATHLLETFIDNSETTTEFIENDGFTMLITSVAN
EIDFTLAHPETWQPPKYSVVYYSISFRELAYIRSLLKLVLKLLSTDSGDRIRNLIDSPIL
VSLKKILENKLVFGLTLITYTLDVVQKVINSEPTIYPVLVEAGLIPYVIDNFPKLIGPSA
ELLSLLPDVVSAICLNPEGLKQVKEKGLINNLFDFLLDADHARILTGGDRSTEYGTDIDE
LARHYPDLKANIVEALCNVIRKMPSTFRNEREFLFTSPKDQKYFFHRKNEEILTDKEEHE
PAYWELLDKGTMLDTFTSVLFGMSLGNGSFSQVPQHLEARDFLAIIFMENPPYEYFTSVA
ISNVTEVLQYLDEKYEDYAFMDVMKVLNDQLENLNDFLNSPNDRSFFLERDGENSVRSCH
SKLCRLAAILNIVTNVYIDLTTLSCKRIMQIYSYFDKRGFSLIKNLKLLFQKCALEEMYI
RQHMPDSVITETMPLPIVDVSGDGPPLQIYIDDPKKGDQKGKITSVKTRNTLQMRTILYT
LQSNTAILFRCFLRLSHSRNMDLEHKDLTTEVHIFENVVENVIEMLKATELEGHLPYILV
LLNFNTFVFTIPKASPNSTEILQTIPAYIFYQKGGYLLYLHIIRDLFTRMTKIKDLSSLD
NINYIDESNGILTLSCLINALTFYNKSMQTETMENVQSIGKYYVSIDDDYNIMKALTVPI
KVMALAMILDLDKSDSLFKTQSRNVPYSVFKQLLSMLKNIFTNVNIYTKELYELHWDLIF
PPIKKISLFEQVGIPGDVAANYLTDTGDDLPADNSIGLFSPEQWEKYKKLIGEDKSIYYP
QPMQAQYYKGCSSKELDELRDTFFNDGLPSRIFTVLPFYPKLVNAFAKTLLQIFTKYDEP
TEVFAGRILDRILETDLDDPATLSSLIHLFGIFLNEKYIYQKASHLMQRFIEYLEKSLKP
EHVNTPWFSKALYVYEIILAKSELPHLEELSKDVLLRYPLLSMAKVFRIPDPMKQKLFDI
LIRVSDISNFYSALATSRILIFYSRDELYANNIARSGILSRLLKVIGSFQKLDKINFLES
SFLLLTRRCFETTENVDALIRAEINRSFTARPLGGGDDAVRELTTILEEKAHVVMRSPSQ
FIDVLCETARFHEFDDQGALVDYSLKRFLGEKDKNTQASSTEKSDIYERTGIMHLLLSQL
MAASEKDWLSEPANSSDLPENKKAQLDPSRNPVCAYMIFLLKLLVELVSSYNQCKFEFLT
FSRRNTYAERPRPRTTAINFFLYRLLDKPVGTDHDKHEAKRREVIGMLARSVIIGFLATV
QDDRTTKTDVKLADPHMNFIRKFAIEAIIKAIRNATSSSKLLESNHLKLDMWFRIITSMV
YVQAPYLRQLLDSNKVEADQYQLCKLVIDLGLPSVITEAMASIDLNYPFSKKIFNVAVEA
LNTISSTRNNFSEHFKIEDHDEVEDEVDESDKEEIPDMFKNSALGMYDVEDIEEDDDDDT
SLIGDDDAMAFVDSDNGFEVVFSDEDDDMGEEDADDARSDSEENELSSEMQSSTADGTDV
DYEVDDADGLIINIDQPSGDDEEMADYDANISHSSHSENEDDASMDVIEVYDDELSSGYD
VDLSDYDVDESDWDSGLSSLSISDEDSESSEDEPINSTRMGDSRRRWLIAEGVELTDDSQ
GESEEDDRGVFRGIEHIFSNENEPLFRVHDEMRHRNHHRSINRTHFHSAMSAPSLSLLNR
GRRNQSNLINPLGPTGLEQVENDISDQVTVAGSGSRPRSHHLHFSEVLVSGSFFDEPVLD
GIILKSTVSRWKDIFDMFYDSKTYANCIIPTVINRLYKVSLALQKDLENKREQEKLKNKN
LLFNEAKVESHNSSDAISVEQDDIQESNVTHDDHEPVYVTIQGSEVDIGGTDIDPEFMNA
LPDDIRADVFAQHVRERRAEARLNSDHNVHSREIDSDFLEAIPEDIREGILDTEAEEQRM
FGRIGSSADVIRADDDVSNNDEEVENGLDHGNSNDRNNADPEKKKPARIYFAPLIDRAGI
ASLMKSVFISKPYIQREIYHELFYRLCSSKQNRNDLMNTFLFILSEGIIDQHSLEKVYNI
ISSRAMGHAKTTTVRQLPSDCTPLTVANQTIEILQSLIDADSRLKYFLIAEHDNLIVNKA
NNKSRKEALPDKKLRWPLWHLFSLLDRKLITDESVLMDLLTRILQVCTKTLAVLSTSSNG
KENLSKKFHLPSFDEDDLMKILSIIMLDSCTTRVFQQTLNIIYNLSKLQGCMSIFTKHLV
SLAISIMSKLKSALDGLSREVGTITTGMEINSELLQKFTLPSSDQAKLLKILTTVDFLYT
HKRKEEERNVKDLQSLYDKMNGGPVWSSLSECLSQFEKSQAINTSATILLPLIESLMVVC
RRSDLSQNRNTAVKYEDAKLLDFSKTRVENLFFPFTDAHKKLLNQMIRSNPKLMSGPFAL
LVKNPKVLDFDNKRYFFNAKLKSDNQERPKLPITVRREQVFLDSYRALFFKTNDEIKNSK
LEITFKGESGVDAGGVTREWYQVLSRQMFNPDYALFLPVPSDKTTFHPNRTSGINPEHLS
FFKFIGMIIGKAIRDQCFLDCHFSREVYKNILGRPVSLKDMESLDPDYYKSLVWILENDI
TDIIEETFSVETDDYGEHKVINLIEGGKDIIVTEANKQDYVKKVVEYKLQTSVKEQMDNF
LVGFYALISKDLITIFDEQELELLISGLPDIDVDDWKNNTTYVNYTATCKEVSYFWRAVR
SFDAEERAKLLQFVTGTSKVPLNGFKELSGVNGVCKFSIHRDFGSSERLPSSHTCFNQLN
LPPYESYETLRGSLLLAINEGHEGFGLA
NT seq 9807 nt NT seq  +upstreamnt  +downstreamnt
atggtgctttttactcggtgtgaaaaggcaagaaaggagaaactcgccgctggttataag
cccttagttgattatttgattgattgtgatactcccacatttttagaaagaattgaggca
atccaagagtgggaccgatccagagatgatctttatgtttggattcccattctagacaga
atggacgggctgttgttaaaagtggcagagaaatataaatacaagcaagaccccaagaag
gagtgtgaagtcaaattggtggaaatggaagcgcatgatgttgattattgtttgaaaatg
ctaaagtttactcgtcgactacttctaaatacagaaaacaggtttgtttattcatctgga
gatgttttaatgtatctactgaattgtccgaattttacaataaaactagcggtcatgcga
attttagccattttaggggaaaggtttgtgattgcgagagaaaaaatagttgcacataac
atatttggagatcacaacctcaggaaaaaaactctcaaactagctttatctctgtcatct
tccgtcatggatgaagacggagagcacttttctcttgtcgatctatattttgataagaaa
aaagtgcctcaaaaatggagaaagttgagatttacacattatacttcaaacgactttaaa
aagtcaagccagcaaaaaaataacattaatgaaacccaaacttccattaagaaggtaact
atgacgacccaagaactgtgtgaacactcactacagcaaatatttgataagggtatggcc
cttttacccgcagaaagttggtttgatttctcaataaaagcttcggtggcgaaggccttc
agtgatgattcaggtgaaaatatagatttgagaaatataattattgaaacaaaactgaat
gctattgcatttgttaacaccattttctcgcctcctcaagtaagctcgaagttatttgaa
ttagatccgtatgcttttaatagtctaactgatttgatatcgttgtctgaaaccaaaata
ccaaaagagctaagaacggatgctttattcacattggaatgtatatccttgaagcatgtc
tggtgctcagacattatcagaaatctcggtggtaacatatcgcatggtctgttgtttcag
attctccgttacattgccaagacattgagagaagcgacagacgaaatcgatgaagaatat
aatgtgaggttcttttacttgatatcaaatttagctgacgttaagcctttgcatgaatct
cttttcgccgcgggtttaatacctactttattggaaattgtatctataagaaattgccca
tataagcgtaccctcgcatctgctacccatctcctagaaacatttatagataacagtgaa
actaccactgaatttatcgaaaatgatgggtttactatgctgatcacttcagtcgccaat
gagattgatttcacgcttgcacatccagagacgtggcaaccgccaaaatattcagtggtt
tattattcaatttcttttagggagttggcatatattagaagtttattgaaactcgttctc
aaattattaagcacagactcaggggatagaattagaaatttaatagattcgccgatactt
gtttcattaaagaaaatcctagaaaataaacttgtattcggtttaacattaataacttac
actctggatgtagttcagaaagtaataaatagtgagcctactatttatcctgttctggtt
gaagcaggacttattccatatgttatcgataattttccaaagttaattgggccttccgcc
gaattattaagtttacttccagatgtcgtttctgccatatgcttgaatccagaagggctg
aagcaagttaaagaaaagggtctcataaacaatttgtttgatttcttactcgatgctgac
cacgcgcgtatattaacaggtggagatcgttctacggaatatggtactgacattgatgaa
ttagcaagacattatccagacttaaaggcaaatatcgtggaggctttgtgtaacgtcatc
agaaaaatgccaagtacctttagaaatgaaagagagtttctttttacttcaccaaaagat
caaaagtacttttttcacagaaaaaatgaggaaatattgacagataaagaggaacatgaa
cctgcatactgggagctattagataagggaactatgctggacacatttaccagtgttttg
tttggtatgtctttaggaaatggttctttttcacaggtgccacaacatctggaagcgaga
gattttctggcaataatatttatggaaaatcctccttatgaatactttacctccgtggca
atctcaaatgttactgaggtcctccagtatctggatgaaaaatacgaagactacgcattc
atggatgttatgaaagtattgaacgatcaattggagaacctgaatgattttttgaatagt
ccaaatgatagaagtttctttttagaaagagatggggaaaactcggtgcgttcatgccat
tcaaaactttgtcgacttgccgctattttgaacattgttacgaatgtatacattgacctc
actaccttatcttgtaagagaatcatgcagatctattcttattttgacaaaagaggattt
tctttaattaaaaacttaaagttgctattccagaaatgtgcgttggaggaaatgtacata
cgccaacatatgccagattctgttattacagaaacaatgccgttgcctatagtggatgtt
tccggagatggaccaccacttcaaatttatatcgatgacccaaaaaagggtgatcaaaag
gggaaaattaccagcgtaaaaacgagaaatactcttcaaatgcgaacaatactgtataca
ttacaatcaaatactgcaattctatttcgctgctttttaaggttaagccactctaggaat
atggatctagagcataaagatttgacgacagaagttcatatatttgagaacgttgttgaa
aatgttattgaaatgttgaaggccaccgaactcgaaggtcatctaccgtatattctcgtt
ttattaaacttcaacacctttgtgtttactattccaaaggcttcccctaattccactgaa
atattacaaacaataccggcttatattttctatcaaaaggggggctatttactttatttg
cacattataagggatctctttacgagaatgacaaaaataaaagatttatcctcacttgat
aacataaactacatagatgagtccaacggtatcctaaccttaagctgtttaattaatgct
ctcaccttttacaacaaatcaatgcaaactgaaaccatggagaatgtccaaagtattggt
aagtattacgtttcaatagatgacgattataatattatgaaagctttaacagttcctatt
aaggtaatggctctcgcaatgattttagatttggataaatcggatagcctcttcaagaca
cagtcccgtaatgtgccttactcagttttcaagcaacttcttagtatgctcaaaaatata
ttcactaatgtgaacatctataccaaggaattatatgaattgcattgggacctaatattc
ccaccaattaaaaaaattagcttgtttgagcaagtcggcattcccggtgatgttgcggca
aactatttaacagatactggtgatgatcttcctgcagataacagtattggcctgttttcg
cctgaacaatgggaaaaatataaaaaattaatcggtgaagataaatccatctactatcca
caaccaatgcaagctcagtattacaaaggatgttcctcaaaagaattagatgagctgaga
gatacctttttcaatgacggtttaccatctaggatcttcactgtactccctttctatcct
aaacttgtaaacgcgtttgcaaaaactttgctacaaatttttacgaaatacgatgaaccc
actgaagtgtttgctggtagaatcttagatcgaattttagagacagatctagatgaccct
gctactttatcttccttaatccatttatttggtatattcctgaacgagaaatatatttat
caaaaggcttcgcatttaatgcaaaggttcattgaatatcttgagaagtctctgaagcca
gaacatgttaatacgccttggttttcgaaagctctttacgtttacgaaattatactggcg
aaatctgagcttccacacctcgaagagctttccaaggatgttcttctgagatatccattg
ctttccatggcgaaagtctttcgcataccagaccctatgaagcagaaattatttgacata
ctgatcagagtttctgatatttccaatttttattctgcactggcaacatcacgcatactt
attttctactctagggatgagttgtatgctaacaacatagctagatcgggaatattatct
agattgttgaaagtaattggaagtttccaaaaactagacaaaataaactttttagagtca
tctttccttttattaaccaggagatgttttgaaacgactgaaaatgttgatgctttaata
cgtgcagaaattaatagaagctttacagcaagaccgttaggtggtggggatgatgctgta
cgtgagttaaccactattctagaagaaaaggcgcatgtggtcatgcgtagtccctctcaa
tttattgacgttctttgcgaaacagctcggttccatgaatttgatgatcaaggtgcgttg
gttgattactcattgaaaagatttcttggtgaaaaagataagaatacgcaagcctcaagt
acagaaaaatcagatatctacgagagaacggggatcatgcatttattactgtcacaactt
atggctgcttctgagaaagactggttgtctgaaccggccaactcctcggatttgcctgag
aacaaaaaagcccaattggacccatcaagaaatcctgtatgtgcttacatgatttttctt
ttgaagcttttggtcgagttagttagcagttacaatcaatgtaaatttgagttcttaact
ttcagtagaagaaacacatatgcagaacgccccagaccaagaacaactgctattaacttt
ttcctttatagattattagacaaacctgtcggaactgaccacgataagcatgaagctaaa
agaagagaggttattggaatgctagcacgttccgtaattattggtttcttggctactgtt
caagatgataggacgaccaagactgacgtcaagcttgctgatcctcacatgaactttatt
agaaaatttgccattgaagcgattataaaagccattcgcaacgccacttcctcttctaaa
cttttggaaagtaatcatttaaagttagatatgtggtttagaatcattacatcgatggtt
tatgtccaggctccatatcttcgccaactacttgattcaaataaagttgaggcagatcag
taccaattgtgcaaactggttatagacctcggtcttccgtcagttatcacggaagccatg
gccagtatagacttaaactatcctttttccaaaaagattttcaacgtcgctgttgaagct
ctaaacacaattagttcgacaaggaacaatttttctgagcacttcaaaattgaagatcat
gatgaagttgaagacgaggttgacgagtctgataaggaagagatcccggatatgttcaaa
aactcagcgctgggaatgtatgacgtagaggacattgaagaagacgacgatgacgacaca
tcattaattggagacgatgatgctatggcatttgttgatagtgataacggatttgaagta
gtatttagtgacgaagatgatgatatgggagaagaagatgcagatgatgctcgttcagat
tcggaagaaaatgaattatcttctgaaatgcaatcaagtacagcggacggcacggatgtg
gactatgaggttgatgatgcagatggactaattatcaatattgaccagccctcaggagat
gatgaagaaatggcagactatgatgctaacattagccattcttctcacagtgaaaatgaa
gatgacgcttcaatggacgtcatagaagtttacgacgacgagctaagttctggatatgat
gttgatttaagcgattatgacgtagatgaatctgattgggactccgggttatccagccta
tctatttctgatgaagatagtgaaagtagcgaagatgagcctattaactccaccagaatg
ggagattcaagaaggagatggctgatagctgaaggcgtggagctaactgacgactcgcaa
ggtgagagtgaagaagatgatagaggtgttttccgtggtattgaacatatattttcaaat
gagaatgagcctttgtttagagttcatgacgaaatgcgtcatagaaaccatcatcgctca
atcaatcgtacccattttcactctgctatgagcgccccctctttaagcttattaaatcgt
ggaagaagaaaccaaagcaacctaataaatccactagggcctacaggattggaacaagtg
gagaacgatatttcagatcaggtgactgttgctggttcaggctctcgcccaagatcacat
catcttcacttttcggaagttctagtctcaggcagcttttttgatgaacctgtcttagat
ggcataattttaaagtctacggtatccagatggaaggatatattcgacatgttttacgac
tctaagacttacgctaactgtattattcctactgttatcaacagattatacaaggtcagt
ttagctttgcaaaaggacttggaaaacaaacgtgaacaagagaaattgaaaaataagaac
ctactattcaacgaggctaaagtagaaagccataacagttctgatgctatatcggtagaa
caagacgatatacaagaaagcaatgttactcatgatgaccacgagcctgtatatgttact
attcaaggttccgaggttgatataggtggtacagatattgatccagaattcatgaatgca
ttgcctgatgatataagagccgatgtctttgcacaacatgttagagaaagaagagcagaa
gctaggctaaattctgatcataacgtacactccagagaaatcgattccgattttctggaa
gcaattcctgaagacatcagagaaggaatattggatactgaggcagaggaacagagaatg
tttggtagaattggctcttcggccgatgtgattagagcagacgacgacgttagcaacaat
gacgaagaagttgaaaacggtttggatcatggaaatagtaatgatcgcaataacgccgac
cctgaaaagaaaaaaccggctagaatatactttgcaccattaattgatcgtgccgggatt
gcctcattgatgaaatctgtgtttatttcgaaaccttatattcagcgtgaaatttatcat
gagcttttctaccgtttatgttctagcaaacaaaatagaaatgatttgatgaatacattt
ttatttatactaagtgaaggtatcatagatcagcactctttggaaaaggtttataacatt
atttccagcagggcaatggggcacgcaaaaaccacgaccgttagacagttaccatcagat
tgtaccccgctaacagtggctaatcaaactatcgaaattttgcaaagtctaattgacgcg
gattctaggctaaaatacttcctgattgcagaacatgacaacctgatagtgaacaaagct
aataacaaatctaggaaagaagccttacctgacaaaaaattaagatggcctttatggcat
ttattctcacttttagatagaaagctcattacagacgaaagcgtattgatggatttgtta
acaagaatattacaagtttgtactaaaacattggctgtcctttctacaagttcaaatggt
aaagaaaatttaagcaaaaagtttcatttacctagttttgatgaggatgatctcatgaaa
attttatccatcattatgcttgatagttgtactacaagagtatttcaacaaacacttaat
ataatttacaacctctctaaattacaaggctgtatgtccattttcacgaaacatttggta
tctttagctatcagcataatgagtaaattaaagagtgctctcgatgggctatcacgtgaa
gtaggcactatcaccaccggaatggagatcaattcagagctgttacagaaatttaccctt
ccaagttctgatcaagctaaattattgaaaattttaactacggttgattttctttacact
cacaaaagaaaagaggaagagcgcaacgttaaagaccttcaatctttatatgataagatg
aacggcggaccagtgtggtcctcattgagtgagtgcttatctcaatttgaaaagagtcaa
gccatcaacacttcagccacaatcttacttccgttgatcgaatcacttatggttgtatgc
aggcgtagtgacttaagtcaaaatagaaacactgcagtcaaatatgaagatgctaaatta
ttggatttttccaaaacacgtgtcgaaaacttatttttcccatttacagacgcacacaag
aagttgttgaatcaaatgattcgttcaaatccaaaactgatgagtggtcctttcgcatta
ttggtcaagaatccaaaagttttggattttgacaacaaaagatatttcttcaatgccaaa
ttgaagtctgataatcaagagcgtcctaaattacctattaccgttcgccgtgagcaggtt
ttcttggactcttatcgagccttatttttcaagacaaacgatgaaatcaagaattctaaa
ttagagataacattcaaaggagaaagtggtgtcgatgccggtggggtaaccagagaatgg
taccaagtactatcgagacagatgttcaaccctgattatgctctttttcttcctgtacca
tcggataaaactactttccatcctaatcggacatcaggtatcaaccctgagcacctttct
ttctttaaatttatcgggatgattatagggaaagcaattagagaccaatgctttttggat
tgccattttagtcgtgaagtatacaagaatattttgggtaggcctgtatcattgaaggat
atggagtctcttgatccagattattataaatcattggtgtggattcttgaaaacgatatc
acagatattatagaggaaactttttctgttgaaactgatgattatggtgaacataaagtt
atcaatttgattgaggggggcaaggatataatagttacagaggccaataaacaggattat
gtgaaaaaggttgtcgaatataaacttcagacatctgttaaggaacaaatggataacttt
ttagtgggtttctatgcccttatatccaaagatctcattacaatatttgatgagcaggaa
ttggagttattaatcagcggtttgcctgatattgatgtcgacgactggaaaaacaatact
acttatgttaattacaccgcaacctgtaaggaagtgagttatttttggagggcagttaga
tccttcgacgctgaagaacgtgccaagttgttgcagtttgttaccggtactagtaaagtt
cctctaaatgggtttaaggaactaagcggtgtcaacggtgtttgtaaattttccatccat
cgtgattttggttcatcagaaagactaccatcatcacatacctgtttcaatcaactgaat
ttacctccttatgaatcatatgagacattgcgtggttcactattattggcaatcaatgaa
gggcatgaagggtttggtcttgcctga

DBGET integrated database retrieval system