KEGG   Saccharomyces cerevisiae (budding yeast): YDR458CHelp
Entry
YDR458C           CDS       T00005                                 

Gene name
HEH2
Definition
(RefSeq) Heh2p
Organism
sce  Saccharomyces cerevisiae (budding yeast)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MSC HeH Thymopoietin
Motif
Other DBs
NCBI-GeneID: 852069
NCBI-ProteinID: NP_010746
SGD: S000002866
UniProt: Q03281
Structure
PDB: 

Position
IV:complement(1380055..1382046)
Genome map
AA seq 663 aa AA seqDB search
MDHRNLDPKTLKVSQLRRVLVENDVAFPANARKPVLVKLFEEKVRQRLQSSPEASKVRTS
IQKVVKSGAKNADRKKTLKSKKLESSSSESKTVKDENVETNKRKREQISTDNEAKMQIQE
EKSPKKKRKKRSSKANKPPESPPQSKSDGKATSADLTSELETVEELHKKDSSDDKPRVKE
LPKPELPNLKVSNEFLAQLNKELASAATENYDHSIKSTDLSSIRIETEEPVGPSTGAETR
NESEVMENINLEVQPEVKEAKEELTKISETFDNQDEEDTSRLSSKKNIRSPKGRTRHFIA
NKTKRGIDIMKPFIAHLFIWLWNGAIFLSIICPILFGLWYREQRIQVGYCGHEKPLKSLA
ISAFPQTERVDSVLQAYRPNCLECPEHGICSSFMNVECEPGYEPKSSILETYGIIPFPKY
CAKDESKEKEVDELVWKVNEYLKKKNAQHECGEGENLFESGETETKLYDIFSHSRPSWES
QREFNDHWKNVLEILKKKDDIIWLPLDFETNGKREKSKSNNTNYIYRSTSKKWVTLQCHL
EGDIQEYITKYGGSLFITLGVLFLIKKIQSTLDNYVQGEQIIEKLVKEAIDKLKDVKKNK
GEEPFLTTVQLRATLLSDIPNIKEQNNLWAQTKEKIMKEQSENIELYLLEENGEIMTCWE
WKE
NT seq 1992 nt NT seq  +upstreamnt  +downstreamnt
atggatcacagaaaccttgatccgaaaacgctgaaggtcagccaattgagaagagttttg
gtagaaaatgatgttgcgttccctgccaacgctaggaagcctgtcttggtgaaattgttt
gaggagaaagtgaggcaacgtctccaatcttcacctgaggcctcaaaggttagaactagc
attcaaaaggttgtgaagtctggggcaaaaaacgcagatcgcaaaaagacattaaagagt
aaaaagcttgaatcaagttctagtgagagtaaaactgtcaaagatgaaaatgttgaaact
aacaagaggaaaagggaacaaattagtacggataatgaagcgaagatgcaaatacaggaa
gagaagtctcctaaaaagaaaagaaagaaaagatctagtaaggccaataaaccaccagag
tctcctccacaatctaagtcagatgggaaagcaacttctgctgatttaacttctgaactg
gaaactgtagaagaacttcataagaaagattcttcggatgacaaaccaagggtaaaagag
cttccaaaaccagaattgccgaatttaaaagtatcaaacgaatttttagctcaactaaat
aaagagttagctagtgcagctacggagaattatgatcattctataaaatccacggactta
tcgtctatcagaatcgaaacagaagagcctgttggtccttcaactggagcagaaacaaga
aatgaaagtgaggtgatggagaatatcaatttggaagtccaacctgaggtgaaggaagca
aaagaagaactaacaaaaatatcagaaacttttgataatcaagacgaagaggatactagt
aggttatcgtcgaaaaaaaatatacgaagtccaaaaggtcgcaccaggcacttcattgcc
aacaaaactaaaagagggatagatattatgaaaccgtttattgcacatctcttcatttgg
ttatggaatggtgctattttcctttcaataatatgtcctattctttttggtctttggtat
cgagaacagagaattcaagtaggatattgcggtcatgaaaagcccctgaaatctcttgca
atctcagctttccctcagactgaaagggtagattcagtgttgcaagcttatcgaccaaat
tgtctcgaatgtcctgagcatggaatatgttcttcttttatgaatgttgagtgtgaacca
ggctatgagcctaaaagttctattttagaaacgtatggtattattccttttccaaaatat
tgtgccaaagatgaaagtaaagaaaaggaggttgatgaactggtttggaaagtaaatgaa
tatcttaaaaagaagaatgcacaacatgaatgtggtgaaggagagaatctctttgagagt
ggtgaaacggaaaccaaattatatgatatattctctcattctagaccgtcatgggaaagt
caaagggaattcaatgatcattggaaaaatgtgcttgaaatattaaagaaaaaagatgat
attatctggctgccattagattttgaaactaatggaaaaagagagaaatctaaatctaat
aacactaactatatttatcgttcaacttcaaaaaaatgggttacgttgcaatgtcattta
gaaggggatatacaggagtatataacgaaatatggtggttctttatttatcaccctaggc
gtccttttccttatcaaaaaaatacaatcgacacttgacaattacgttcaaggagagcag
ataattgagaaattggtaaaagaggcaattgataaattgaaagatgtaaagaagaacaaa
ggtgaagaaccttttctgacaacagttcaactaagagctactttattgagcgacatacca
aatataaaagaacagaataatctatgggctcaaacgaaagaaaaaatcatgaaagagcaa
tcagagaatatagaattatatcttcttgaagaaaatggagagatcatgacatgttgggaa
tggaaagaatga

DBGET integrated database retrieval system