KEGG   Saccharomyces cerevisiae (budding yeast): YDR464WHelp
Entry
YDR464W           CDS       T00005                                 

Gene name
SPP41
Definition
(RefSeq) Spp41p
Organism
sce  Saccharomyces cerevisiae (budding yeast)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF3020
Motif
Other DBs
NCBI-GeneID: 852075
NCBI-ProteinID: NP_010752
SGD: S000002872
UniProt: P38904
Position
IV:1388872..1393179
Genome map
AA seq 1435 aa AA seqDB search
MAYDEDDGEINFNELVGNLLSSHNQEGQEEGEVQGGEQEGDDFEKIYPTSENIEPKHPDD
SQHMHNSPDQNIEIPHFVDEEDELVSVVANAVQNIDDEQAKPENHLENGSEHVTSDTADD
NHEKEQQQEWAHILQQEILKSDGEPLRENTERRVSTSQHHPSQRTDDALDQDDENLRMAI
LESLQELNTNEEEEKEPEKHEHAAPNDKLSSKKSSKKKKKDKSKNRESSKDKSSKKSKSS
SHSKKHAKDRNKEKQSKPTNNENTLDLSNILENLIHENDNAAIDTAKQTVDIQDNSHTDN
TNNEDVEAQALVEATLKAFENELLSSAPTEEPSQEQSIGPVSSRKAVEPPRKPTADDIPL
AMLQAFKPKKRPPQEKKKTKSKTSKAASTANKSPASESTSKKKKKKKTVKESNKSQEAYE
DDEFSRILADMVNQVVNTSLKETSTHTATQDNKLESESDFTSPVQSQYTTEDASTANDDS
LDLNQIMQNAMAMVFQNQNDDEFDENIVEDFNRGLGDLSVSDLLPHDNLSRMEKKSVPKS
SSKSEKKTAISRRASKKASRDASSVELTEVPSKPKKPSKTEVSLEKKLRKKYVSIANEAA
SVARKKRWAKNKELKEKEKLERQTAREERRHKKKLEKQRLAEEQEELKKIVERGPPYPPD
LRLTKSGKPKKPYRRWTPEELLKRSQEAEKPRKVKKERKKKEKKMKVPSSALKKIPLFNF
VKGNVQPSARHRLNDIEGSLSTIGLHKSPDGVRRILSRPKSEDHEWPLSDSSASQNYDAH
LKTVVHKEKIPFHPPWTIPSQPPFALPVARRKKIPNIKKYRKRTNNSFRVSKEGTASTRN
RILPAILLPIINTLKAAAKSQTAAGATPEEARKRLATIIQHAKSTVIRAALQARKNSMQA
AHSKGTTTELATTASRMKNPLKMIPIFNTSRVKQQLDKQLPARSAGTEISSSESPDKATP
DPHSNSTIAGHTLKGVTTPIKIEDSDANVPPVSIAVSTIEPSQDKLELTKRAESVEPVEN
NVETAKETQSVQEIKENVGTKASEEVTLTEDKTNGDPKNEKRILIESPVEKTDKKKPGEK
IATDLNEDASLSDKKDGDEKSTLHSDAAQLTGNEPDSVNTTTGKPKLIDVSLKPLNEAKP
KIPIIFPLKRPQIKPEVSVINLVQNLVNTKIPEIKNESVDLGSNITDILSSTITNILPEI
TATDVKNYQYEDENVKYLKKTPRQVLNLDGLVPPSGRCITKAKRVRRIKKLSADATTAPE
ADGKANSESITYTFDIPSPEEVQSKRSVVLKFAKARLTEAELSCLKKEINNVRKRRWREM
NSTKNWEYDVKSRLKKRANAFFGEGESETKSKWIEERFQEKVSQEKYKDRLETTETQANN
TKIVIDDKEILNILAVNMNNLNKARCIEKDIQESFREEKLASLQPKKKRKKSILH
NT seq 4308 nt NT seq  +upstreamnt  +downstreamnt
atggcttatgatgaagatgatggagagataaattttaatgaacttgtggggaacttacta
agctcacataaccaagagggacaagaggaaggagaagtgcaaggaggagaacaggaagga
gatgattttgaaaaaatatatcctaccagtgaaaatatagaaccaaagcatccagatgac
agccagcatatgcataattctcctgaccagaatatcgaaataccacattttgtcgacgaa
gaagatgagctagtatctgtcgttgcaaatgcggttcaaaatatagacgatgagcaagcc
aaaccggaaaatcatctggaaaatggatcagaacatgtaacatcggatacagcggatgat
aatcacgaaaaagaacaacagcaagaatgggctcatatcttacagcaggaaatattaaaa
tcagacggagagcccttgcgggagaatacagaaaggcgtgtaagcactagtcagcaccat
ccctctcagcgtactgatgacgctctcgaccaagatgatgaaaatttgaggatggctatc
ctagagtctctacaagaattaaacacaaatgaggaggaagagaaagagccggaaaaacat
gagcatgctgccccgaatgataagttgagcagcaaaaaatcttcaaagaaaaagaaaaaa
gataaatccaagaacagagaatcatcaaaggataaatcctcaaagaagagtaaatcttcg
agccattccaaaaagcatgccaaagaccgtaataaagaaaagcaaagtaaacctactaat
aatgaaaatacccttgatttaagtaatatactagaaaatctgattcatgaaaatgacaat
gctgcaatagacactgccaaacaaacagttgatattcaagataactcccatactgataat
acaaacaacgaagatgtggaagcgcaagctttagtggaagcgacactaaaagcatttgaa
aacgagctgctaagctctgcgccaaccgaggagccttcacaagaacagtcgattgggcct
gtatcttctagaaaagcagttgaaccaccacgaaaaccgactgcagacgatattccattg
gctatgttacaggcttttaaaccgaaaaagaggcctcctcaagagaagaaaaaaacaaaa
agtaagacatccaaggctgcatctacagcaaataaatcacctgcatctgaatctacctcc
aagaaaaagaaaaagaagaaaactgtaaaggaaagtaataaatctcaagaagcttacgaa
gatgatgaattttccagaatattagccgatatggttaaccaagtggttaacacttcatta
aaagaaacatcaacgcatactgccacacaggataataaattagaaagcgaaagtgatttt
acttcccctgtacaaagtcaatatactactgaggatgcaagcacagctaatgatgactcg
cttgacttgaatcaaatcatgcaaaacgcaatggctatggtttttcaaaatcaaaacgac
gatgaatttgatgagaacattgttgaagactttaatcgtggtttaggcgatctgagtgtt
tccgatttactgccgcatgataacctttctaggatggaaaagaaatcggtgcctaaaagt
tcgagcaaatctgaaaagaaaacagctatatctaggagagcttccaaaaaggcatctaga
gatgcctcaagtgtagaattgactgaagtaccttcaaaaccgaagaaaccttccaagaca
gaagtatctttagaaaagaagttacgcaaaaaatacgtctctattgccaacgaggctgca
tctgtggctagaaagaaaagatgggctaaaaacaaagaactaaaggagaaagagaaactt
gaacgccaaactgccagagaggaaaggagacataaaaaaaaactagagaagcagaggttg
gctgaagaacaagaggaactgaaaaaaattgttgaacgaggtccaccttatcccccagat
ttaagactaactaaaagcggtaaaccaaaaaaaccatacagaagatggactccggaagag
ctactgaaacgatcacaggaagctgaaaaaccgaggaaggtgaaaaaggaaagaaagaaa
aaggaaaagaaaatgaaggtaccttcatctgctttgaagaaaattcctctcttcaacttt
gtaaagggtaatgttcagccaagtgcaagacatcgtctgaatgacattgaaggttcgcta
tccactattggattacataaatcgcctgacggtgtccgcaggattctttcgagaccaaag
agtgaagatcacgaatggcccctatcagattcatctgcatctcaaaattacgatgcacac
ctaaaaactgtagtgcataaagaaaaaattcctttccatcccccatggactataccgtct
caaccaccatttgcactacccgtagctagaagaaagaaaataccaaatatcaaaaagtat
agaaagagaaccaataattcttttcgtgtctccaaagaaggtacggcaagtactaggaac
agaattttaccggccatattactaccgataataaatacattaaaagctgctgcaaaatcg
caaacagctgctggcgccacacctgaggaggcaaggaaacggctggcaaccattattcaa
catgccaagtctacagttattagggcagctttacaagcaaggaaaaacagtatgcaagcc
gctcattctaagggaactaccacagaactggcaacaactgcgtctcgaatgaagaatccg
ctgaaaatgattcctattttcaatacatctcgagtgaaacaacaattagacaaacaatta
ccggccagaagtgcaggaacagaaatcagcagctctgaatcccctgataaagccacgccc
gatccccactctaattctacaatcgctgggcatactttaaagggcgttactacgccaatt
aaaatagaagacagcgatgcgaatgttcctcctgttagtatagcggtttcaactatagaa
ccatcacaagataaactagaacttacgaagagggcagagagcgtagaacctgtggaaaat
aatgttgaaacagcgaaagaaacccaaagcgtacaagaaattaaggagaatgtcggtacc
aaggcttctgaggaagttactctaactgaagacaagacaaatggggatccaaaaaatgaa
aagaggatattaattgaatctcctgtcgaaaaaacggataaaaagaagccaggtgagaaa
attgctacagatttgaatgaagatgcgagcctgtctgataagaaagatggagatgaaaag
tctacattgcattctgatgcagcccaacttacgggtaatgaaccagacagtgtaaacacg
acaacaggaaagcccaaattaattgatgtttctctcaaaccgttaaatgaagcaaaacca
aaaattcccatcatatttcccttaaaaagaccgcaaattaagcctgaagttagcgttatt
aatttagttcaaaatttggtaaataccaaaatacccgaaataaagaatgaatccgttgat
ttgggaagtaatatcaccgacattctttcctctactatcactaatattctgcccgaaatc
acagccactgatgttaaaaactaccagtatgaagatgaaaacgtaaaatacctgaaaaaa
acaccaagacaggttttgaatttggatggactagtgcctccatcgggtagatgtattacc
aaagctaaacgtgtccgccgcattaaaaagctttctgctgacgccactaccgcaccggaa
gccgatggaaaggcaaacagcgaatccattacttacacattcgatataccatctccagaa
gaggtacaaagtaagcgtagtgtagtcctaaaatttgccaaggctagattgaccgaggcg
gagttgagttgtctaaagaaggagattaacaatgtgaggaaacggagatggagagagatg
aactccaccaagaactgggaatatgacgtaaagtctagattaaaaaagcgtgcgaacgca
ttttttggggaaggagaatcagaaacgaagtctaaatggatcgaagaaagatttcaagaa
aaggtaagtcaagaaaagtacaaggatcgccttgaaactactgagacgcaagcaaacaac
acgaagattgtgattgacgacaaggagattttgaatattcttgcggtaaacatgaataac
cttaacaaagcacgctgtattgaaaaagatattcaagagtcgttcagggaggagaagtta
gcctctttacaaccaaagaagaagagaaagaaaagcattttacactga

DBGET integrated database retrieval system