KEGG   Saccharomyces cerevisiae (budding yeast): YDR465CHelp
Entry
YDR465C           CDS       T00005                                 

Gene name
RMT2
Definition
(RefSeq) protein-arginine N5-methyltransferase
  KO
K18477  type IV protein arginine methyltransferase [EC:2.1.1.322]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Brite
KEGG Orthology (KO) [BR:sce00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:sce03036]
    YDR465C (RMT2)
Enzymes [BR:sce01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.322  type IV protein arginine methyltransferase
     YDR465C (RMT2)
Chromosome and associated proteins [BR:sce03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    PRMTs (protein arginine metyltransferases)
     YDR465C (RMT2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-GeneID: 852076
NCBI-ProteinID: NP_010753
SGD: S000002873
UniProt: Q03305
Position
IV:complement(1393336..1394574)
Genome map
AA seq 412 aa AA seqDB search
MSELHALLTFPERPISQSYYVPKLQHFLKSGIPATYTLEQVAAFEHEEKNRNGDKEFRES
TDDNKTSNTTPLHVLARSLPLDIKDEELQVVMDMMNILFEYGAGWNFIDYEDKTVGDLFL
ERNQSRESPLYRRLVEAGVSAELLLRKLNGGDVEFLDTDELIGIEPEESVQTAVDGQKEE
SVGSDDDATAANQQVYLKTELEYKDDALITKENKDGVMMDWETKIMELASETLFPDPEAT
NSATILNIGFGMGIIDTFIQARKPYRHYICEAHPDVLAKMKMDGWYEKDNVVILEGRWQD
TLNNLLDKGEVFFDGIYYDTFSEHYQDILDLYDVVVGLIKPEGVFSFFNGLGADRSLCYD
VYKEIVEIDVATYGMKCDYTRYSLDEQLPDWNDVKRSYFNCNYYYHPRITFA
NT seq 1239 nt NT seq  +upstreamnt  +downstreamnt
atgtcagaattacatgctttgcttactttcccagagaggcccatttctcaaagttactat
gtaccaaaactgcagcatttcttaaaatctggtataccggctacatatactttggagcag
gtcgcagccttcgagcatgaggaaaagaacaggaacggggataaggaattcagagagagc
actgacgacaataaaacctcaaacacaacgccgttacacgttttagcaagatcgctaccc
ttggatatcaaggatgaggaactgcaagtggtgatggatatgatgaatattctttttgag
tatggggctggatggaattttattgactacgaggacaaaacagtgggtgatttgttttta
gagagaaatcaaagtagggagagccctctttatagacggctcgtggaagctggtgtgtct
gctgaattattactgagaaaactcaatggtggcgacgtcgaattcttggatacagatgaa
ctaataggtatcgagcctgaggaaagcgttcaaacagcagttgatggtcaaaaagaagaa
tcagttggtagtgatgacgatgctaccgcggcaaatcaacaagtgtacttaaaaacagaa
ctagagtacaaagacgatgcgcttatcacaaaggaaaataaggacggtgttatgatggat
tgggaaaccaagattatggaacttgcttccgaaaccttatttcctgatccagaggccact
aattctgctacgatcttaaacattggatttggaatggggatcatcgatacattcatccaa
gctcgaaaaccatatcgtcactatatttgcgaagctcatccagatgttttggccaagatg
aaaatggatggttggtatgaaaaggataatgtggttattttagagggaagatggcaagat
acgttgaataatttattagacaaaggtgaagttttctttgatggtatttattatgataca
tttagcgagcactaccaagacatattggacttatacgatgtcgtggtaggtttaattaaa
ccagaaggcgttttctcatttttcaacggattaggcgctgacagatcgttgtgttacgat
gtatataaagaaattgttgagatcgatgttgctacatatggtatgaaatgcgattacacc
agatattctcttgacgagcaattgccagattggaatgatgttaagcggtcttactttaac
tgtaactattattaccatccacgtatcacgtttgcttaa

DBGET integrated database retrieval system