KEGG   Saccharomyces cerevisiae (budding yeast): YDR468CHelp
Entry
YDR468C           CDS       T00005                                 

Gene name
TLG1
Definition
(RefSeq) Tlg1p
  KO
K08499  member of the syntaxin family of t-SNAREs
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce04130  SNARE interactions in vesicular transport
Brite
KEGG Orthology (KO) [BR:sce00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04130 SNARE interactions in vesicular transport
    YDR468C (TLG1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:sce04131]
    YDR468C (TLG1)
Membrane trafficking [BR:sce04131]
 SNARE
  SNAP-25[C] (Qc)
   STX6
    YDR468C (TLG1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SNARE Syntaxin-6_N NBD_C Sec20 DUF1043 DUF2207 RmuC Ferritin Spc7 SKA1 DUF892 CLZ
Motif
Other DBs
NCBI-GeneID: 852079
NCBI-ProteinID: NP_010756
SGD: S000002876
UniProt: Q03322
Structure
PDB: 

Position
IV:complement(1398026..1398700)
Genome map
AA seq 224 aa AA seqDB search
MNNSEDPFQQVVKDTKEQLNRINNYITRHNTAGDDDQEEEIQDILKDVEETIVDLDRSII
VMKRDENEDVSGREAQVKNIKQQLDALKLRFDRRIQESTQTTIPLEETVENSTLNTSMAE
NNDGGMSNPFQEQMLREQDVHLDGIHKTMQNLHIQAQTMGDELENQGQLLDNMDEGMDGV
VNKLARGRRQLEWVYEKNKEKYDDCCIGLLIVVLIVLLVLAFIA
NT seq 675 nt NT seq  +upstreamnt  +downstreamnt
atgaacaacagtgaagatccgtttcaacaagttgttaaggacaccaaggagcaattgaac
cgcataaacaattacataactcgtcacaatactgctggtgatgacgatcaagaggaggaa
atacaagatattttaaaggatgttgaggaaacaatagttgatttggacagaagcataatc
gtaatgaaaagggatgaaaacgaagacgtgagtggtagggaagcacaagttaaaaatata
aaacagcaacttgatgctctgaagttgcgttttgatcgaagaatacaggaatctactcaa
acaactattcctctagaagagacggtggaaaattcaacacttaacaccagcatggctgag
aacaatgatggtggtatgtccaatccgtttcaggaacaaatgttaagagaacaagatgtt
catttagatggtattcacaagacaatgcaaaatttgcatattcaagctcaaacaatgggg
gatgaattagagaaccagggacaattgttggataatatggacgagggtatggacggtgtt
gtaaataagctggctagaggtcgtaggcaattggaatgggtctacgaaaaaaataaagaa
aaatacgacgattgttgtataggacttcttattgtcgtcttgatagttttattagttttg
gcattcattgcttga

DBGET integrated database retrieval system