KEGG   Saccharomyces cerevisiae (budding yeast): YDR469WHelp
Entry
YDR469W           CDS       T00005                                 

Gene name
SDC1, CPS25, SAF19
Definition
(RefSeq) Sdc1p
  KO
K14968  COMPASS component SDC1
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Brite
KEGG Orthology (KO) [BR:sce00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:sce03036]
    YDR469W (SDC1)
Chromosome and associated proteins [BR:sce03036]
 Eukaryotic Type
  Histone modification proteins
   HMT complexes
    COMPASS/SET1 complex (yeast)
     YDR469W (SDC1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dpy-30 DUF3224
Motif
Other DBs
NCBI-GeneID: 852080
NCBI-ProteinID: NP_010757
SGD: S000002877
UniProt: Q03323
Structure
PDB: 

Position
IV:1399015..1399542
Genome map
AA seq 175 aa AA seqDB search
MNESENSPQHNEVTVPMVEDTSSNADIPMEQIQREDNKNYDKHDNECFDMNGNHNNNSDN
LQFDSVPSSATKDLKNIKSVTNQNVKIEESSSTNSVIEESSEPKISKLENVNLAATVGGS
QTRKYLNTNVTPHLLAGMRLIAVQQPEDPLRVLGEYLIEQSNILKSGEKESNASK
NT seq 528 nt NT seq  +upstreamnt  +downstreamnt
atgaatgaaagtgagaatagtccccaacataatgaagttacggttcctatggtagaggat
acttcaagtaatgctgatattccaatggagcaaattcaacgcgaagacaataagaactac
gataaacatgacaatgaatgcttcgatatgaatggcaatcacaataataactctgataac
ttacaatttgacagtgtaccatcttctgcaacgaaagatttgaaaaacatcaaaagtgtc
accaaccaaaatgtaaaaatagaagaatcgagtagcacaaattcagtcattgaagagtca
tctgaacctaaaatatcaaaattagaaaatgtgaaccttgccgcgacggtaggtggttca
caaactagaaaatacctgaatacaaatgtgacaccgcatttattagcgggcatgaggctc
atagccgtacaacaaccagaagatccgttacgtgttttaggtgaatatctaatcgagcag
agcaatatactgaagagtggagaaaaagagagtaatgctagtaaatga

DBGET integrated database retrieval system