KEGG   Saccharomyces cerevisiae (budding yeast): YDR477WHelp
Entry
YDR477W           CDS       T00005                                 

Gene name
SNF1, CAT1, CCR1, GLC2, HAF3, PAS14
Definition
(RefSeq) AMP-activated serine/threonine-protein kinase catalytic subunit SNF1
  KO
K12761  carbon catabolite-derepressing protein kinase [EC:2.7.11.1]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce04113  Meiosis - yeast
sce04138  Autophagy - yeast
Brite
KEGG Orthology (KO) [BR:sce00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04138 Autophagy - yeast
    YDR477W (SNF1)
  09143 Cell growth and death
   04113 Meiosis - yeast
    YDR477W (SNF1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sce01001]
    YDR477W (SNF1)
Enzymes [BR:sce01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     YDR477W (SNF1)
Protein kinases [BR:sce01001]
 Serine/threonine kinases: CAMK group
  CAMKL family
   YDR477W (SNF1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase AdenylateSensor Pkinase_Tyr UBA_2 Kinase-like YukC RIO1 Haspin_kinase Kdo APH
Motif
Other DBs
NCBI-GeneID: 852088
NCBI-ProteinID: NP_010765
SGD: S000002885
UniProt: P06782
Structure
PDB: 

Position
IV:1412373..1414274
Genome map
AA seq 633 aa AA seqDB search
MSSNNNTNTAPANANSSHHHHHHHHHHHHHGHGGSNSTLNNPKSSLADGAHIGNYQIVKT
LGEGSFGKVKLAYHTTTGQKVALKIINKKVLAKSDMQGRIEREISYLRLLRHPHIIKLYD
VIKSKDEIIMVIEYAGNELFDYIVQRDKMSEQEARRFFQQIISAVEYCHRHKIVHRDLKP
ENLLLDEHLNVKIADFGLSNIMTDGNFLKTSCGSPNYAAPEVISGKLYAGPEVDVWSCGV
ILYVMLCRRLPFDDESIPVLFKNISNGVYTLPKFLSPGAAGLIKRMLIVNPLNRISIHEI
MQDDWFKVDLPEYLLPPDLKPHPEEENENNDSKKDGSSPDNDEIDDNLVNILSSTMGYEK
DEIYESLESSEDTPAFNEIRDAYMLIKENKSLIKDMKANKSVSDELDTFLSQSPPTFQQQ
SKSHQKSQVDHETAKQHARRMASAITQQRTYHQSPFMDQYKEEDSTVSILPTSLPQIHRA
NMLAQGSPAASKISPLVTKKSKTRWHFGIRSRSYPLDVMGEIYIALKNLGAEWAKPSEED
LWTIKLRWKYDIGNKTNTNEKIPDLMKMVIQLFQIETNNYLVDFKFDGWESSYGDDTTVS
NISEDEMSTFSAYPFLHLTTKLIMELAVNSQSN
NT seq 1902 nt NT seq  +upstreamnt  +downstreamnt
atgagcagtaacaacaacacaaacacagcacctgccaatgcaaattctagccaccaccac
caccatcaccaccatcaccaccaccatcacggtcatggcggaagcaactcgacgctaaac
aatcccaagtcgtccttagcggatggtgcacatatcgggaactaccaaatcgtcaaaacg
ctgggagaggggtcctttggtaaagttaaattggcatatcataccactacgggccaaaaa
gttgctctaaaaatcattaataagaaggttttggcaaagagtgatatgcagggcagaatt
gaaagagaaatatcttatctgagactcttaagacacccccacatcatcaaactgtatgat
gttatcaaatccaaagatgaaatcattatggttatagagtacgccgggaacgaattgttt
gactatattgttcagagagacaaaatgagcgagcaagaggcaagaagatttttccagcag
atcatcagtgccgtcgagtactgccataggcacaaaattgtccatagagatctgaagcct
gaaaacttactactagatgagcatctgaatgtaaagattgccgattttggtttgtcaaac
atcatgactgatggtaatttcttaaagacttcttgtggttctcccaattatgcggctcct
gaagttatcagcggtaagctgtacgcaggcccagaagtggacgtgtggtcatgtggggtt
atcctttatgttatgctttgtcgtcgtctaccgtttgacgatgaaagcatcccagtgctt
ttcaagaatatcagcaacggtgtttacaccttgcctaaatttttatctcctggagctgct
gggctaatcaaaagaatgttaatcgttaatccattgaacagaataagcattcatgaaatt
atgcaagacgattggttcaaagttgacctgccagaatatctacttccaccagatttgaaa
ccacacccagaagaagagaatgaaaataatgactcaaaaaaggatggcagcagcccagat
aacgatgaaattgatgacaaccttgtcaatattttatcatcgaccatgggttacgaaaaa
gacgagatttatgagtccttagaatcatcagaagacactcctgcattcaacgaaattagg
gacgcgtacatgttgattaaggagaataaatctttgatcaaggatatgaaggcaaacaaa
agcgtcagtgatgaactggatacctttctgtcccagtcacctccaacttttcaacaacaa
agcaaatcccatcaaaagagtcaagtagatcatgaaactgccaagcaacacgcaagaagg
atggcaagtgctatcactcaacaaaggacatatcaccaatcacccttcatggatcagtat
aaagaagaagactctacagtttccattttgcctacatctttacctcagatccacagagct
aatatgttagcacaaggttcgccagctgcctctaaaatatctcctcttgtaacgaaaaaa
tctaaaacgagatggcattttggtatacgatctcgctcatatccattagacgttatgggt
gaaatttatattgccttgaagaatttgggtgccgaatgggccaagccatctgaagaggat
ttatggactatcaaattaaggtggaaatatgatattggaaacaagacaaacactaatgaa
aaaatacctgatttaatgaaaatggtaattcaattatttcaaattgaaaccaataattat
ttggtggatttcaaatttgacggctgggaaagtagttatggagatgatactactgtttct
aatatttctgaagatgaaatgagtactttttcagcctacccatttttacatttaacaaca
aaactaattatggaattagccgttaacagtcaaagcaattga

DBGET integrated database retrieval system