KEGG   Saccharomyces cerevisiae (budding yeast): YDR492W
Entry
YDR492W           CDS       T00005                                 

Gene name
IZH1
Definition
(RefSeq) PAQR-type receptor
  KO
K07297  adiponectin receptor
Organism
sce  Saccharomyces cerevisiae (budding yeast)
SSDB
Motif
Pfam: HlyIII DUF4118
Other DBs
NCBI-GeneID: 852102
NCBI-ProteinID: NP_010780
SGD: S000002900
UniProt: Q03419
Position
IV:1434924..1435874
AA seq 316 aa
MSITTTRRRNQDSVCCKATRASIKVEAVSGQTVFEKQKLLHNFDELPEWQKDNDKILTGY
VRETLSWKKCLYSLFYWNNETVNIYTHLVPAIVYFVFAITLTNYFLIPVFPSTSWSDYTV
INIFLMGAFSCLMCSSCFHCMKQHSEKQSNFWSKLDYLGIISLISCSMIPIIYFGYFDHI
SYFSLFTIVTLVLATFCTVCVLHDKFNTSTFRPFRAMFFILFGFSGLLPLTTGFFKFGIQ
GVLNRIKVSFVFWEALFYISGAVIYGFRIPETLAPGKFDFFGSSHQIFHIMVVLGSVCHL
KAIIDSYKLMHSHIHP
NT seq 951 nt   +upstreamnt  +downstreamnt
atgagtatcaccactactagaagaagaaaccaagatagtgtctgctgcaaggcaacgaga
gcctccattaaggtggaagctgtctcaggccagacagtttttgaaaagcaaaaactgcta
cacaatttcgatgagttgccagaatggcaaaaagataatgacaaaattctcaccgggtac
gttcgtgaaacactgtcatggaaaaagtgcttatattctttattttattggaacaacgag
actgtgaacatttatacacatttggtaccggctatcgtatacttcgtgtttgccattacg
ttgaccaactactttctaattcccgttttcccctccacttcctggtccgattacaccgtt
ataaacattttcttgatgggcgctttctcatgtctcatgtgcagtagctgtttccactgc
atgaagcaacactctgaaaagcaaagcaatttctggagcaagctcgactacttggggatt
atcagtttgatttcctgttctatgatccctataatatactttggttacttcgaccacata
tcctacttcagtcttttcacgattgttactttagtcctggcaacattttgtacagtctgt
gtcctccacgacaagtttaacacttccacatttcgtccatttagggccatgtttttcata
ttgtttggatttagtggcttactcccattgaccacagggtttttcaagttcggtatccaa
ggggttcttaacagaataaaagtcagctttgtgttttgggaagctctcttttacatttca
ggggctgtaatctacgggtttaggattcctgaaactttggctccagggaagttcgatttc
ttcggtagctctcatcaaatatttcatattatggtggttcttggttctgtatgccacttg
aaagccattatcgattcttacaaattaatgcattctcatatccacccttga

DBGET integrated database retrieval system