KEGG   Saccharomyces cerevisiae (budding yeast): YDR502CHelp
Entry
YDR502C           CDS       T00005                                 

Gene name
SAM2, ETH2
Definition
(RefSeq) methionine adenosyltransferase SAM2
  KO
K00789  S-adenosylmethionine synthetase [EC:2.5.1.6]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce00270  Cysteine and methionine metabolism
sce01100  Metabolic pathways
sce01110  Biosynthesis of secondary metabolites
sce01230  Biosynthesis of amino acids
Module
sce_M00034  Methionine salvage pathway
Brite
KEGG Orthology (KO) [BR:sce00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    YDR502C (SAM2)
Enzymes [BR:sce01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.6  methionine adenosyltransferase
     YDR502C (SAM2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: S-AdoMet_synt_C S-AdoMet_synt_N S-AdoMet_synt_M AdoMet_Synthase
Motif
Other DBs
NCBI-GeneID: 852113
NCBI-ProteinID: NP_010790
SGD: S000002910
UniProt: P19358
Position
IV:complement(1453310..1454464)
Genome map
AA seq 384 aa AA seqDB search
MSKSKTFLFTSESVGEGHPDKICDQVSDAILDACLEQDPFSKVACETAAKTGMIMVFGEI
TTKARLDYQQIVRDTIKKIGYDDSAKGFDYKTCNVLVAIEQQSPDIAQGLHYEKSLEDLG
AGDQGIMFGYATDETPEGLPLTILLAHKLNMAMADARRDGSLPWLRPDTKTQVTVEYEDD
NGRWVPKRIDTVVISAQHADEISTADLRTQLQKDIVEKVIPKDMLDENTKYFIQPSGRFV
IGGPQGDAGLTGRKIIVDAYGGASSVGGGAFSGKDYSKVDRSAAYAARWVAKSLVAAGLC
KRVQVQFSYAIGIAEPLSLHVDTYGTATKSDDEIIEIIKKNFDLRPGVLVKELDLARPIY
LPTASYGHFTNQEYSWEKPKKLEF
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
atgtccaagagcaaaactttcttatttacctctgaatccgtcggtgaaggtcacccagac
aagatttgtgaccaagtttctgatgctattttggacgcttgtttagaacaagatccattc
tccaaggttgcctgtgaaacagctgccaaaactggtatgattatggttttcggtgaaatt
accaccaaagctagacttgactaccaacaaatagtaagagataccatcaagaagattggt
tatgacgattctgccaagggtttcgactacaagacatgtaatgttttagtagctatcgaa
caacaatctccagatatcgctcaaggtctgcactatgaaaagagcttagaagacttaggt
gctggtgaccaaggtataatgtttggttacgctacagacgaaactccagaagggttacca
ttgaccattcttttggctcacaaattgaacatggctatggcagatgctagaagagatggt
tctctcccatggttgagaccagacacaaagactcaagtcactgtcgaatacgaagacgac
aatggtagatgggttccaaagaggatagataccgttgttatttctgctcaacatgctgat
gaaatttccaccgctgacttgagaactcaacttcaaaaagatattgttgaaaaggtcata
ccaaaggatatgttagacgaaaataccaaatatttcatccaaccatccggtagattcgtc
atcggtggtcctcaaggtgacgctggtttgaccggtagaaagattattgtcgacgcttac
ggtggtgcctcatccgtcggtggtggtgccttctccggtaaggactattccaaggtcgat
cgttccgctgcttacgctgctagatgggttgccaagtctctagttgccgctggtttgtgt
aagagagtccaagtccaattttcatatgctattggtattgctgaaccattgtctttacat
gtggacacctatggtacagctacaaaatcagatgacgaaatcattgaaattattaagaag
aacttcgacttgagaccaggtgtgttagtaaaggaattagatttggctagaccaatttac
ttaccaaccgcttcttatggtcacttcactaatcaagagtactcatgggaaaaaccaaag
aaattggaattttaa

DBGET integrated database retrieval system