KEGG   Saccharomyces cerevisiae (budding yeast): YDR505CHelp
Entry
YDR505C           CDS       T00005                                 

Gene name
PSP1, GIN5
Definition
(RefSeq) Psp1p
Organism
sce  Saccharomyces cerevisiae (budding yeast)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PSP1
Motif
Other DBs
NCBI-GeneID: 852116
NCBI-ProteinID: NP_010793
SGD: S000002913
UniProt: P50896
Position
IV:complement(1456695..1459220)
Genome map
AA seq 841 aa AA seqDB search
MDLPTVNSTTSISDNVDLKNYYEDLLFKNNSGKSLSDLPRKLNDNSNNSGSDTVDPLAGL
NNLRNSIKSAGNGMENRRTFDDIDFMGRFPYLPPVPNQQQQPFSHQNGFIQEHPSSNLTS
FQMSSSNSEPMSAPPISSNNNNLNSTQMGNYQAQQRSFPQFNGNSFHSNGNDLMGNRMDS
DYMRLMNKTNIGFTSNSGSNFAAPSHSAGNPSSMNNQQVPSFNWQQPSHPESTIRRSSYI
SDTLINHQMPDARQKQTSQVQQQHAQGFNLFNSRFNYDNLNSTHLTAKGVPEFGNGVQPP
YPYDNEPNNASISNSNNNNNSHNMVPMQQFRRNTQPVASFNPSLPTFQQQQQQPQQPQQP
RNVNVPTSFNGERVDDVQLVQLQRSSSVPSSTNSHNLQNENSNEGNVSLDNGLVLIQGKH
LTSSKTLHDLYSDCGSGYFASSAVFEFTDNIKKMLKLHDSNESYDAKNMGLIDEEGNTYQ
SLLNFLDILRSCNMNYVNDPESNNGIVSNNGGNKNRRKGSFTTELSCRNANNSFLPYTPL
VLVALKNGKLELLSTPQATNLLLKRGDLVIIDGDRGRDLVLVVEPSVDLNLALFINFLKK
KIHFDSLITSESQHYRNDEFIQMLIDSKNGQKKKLNPKLYDVVELTELIIPSKQVLRFAT
PWEVTTNLHNKFEDELKALHIAQSKLQALNDNSKSQNTNDSSSNNFTNAATYSKPKLNIK
ILNAEFQFDRKKLTFYYVCEERNDFRDLIKELFKYYKTRIWLCAIPNNLSIDSKYYDKQQ
KELKLYQNIVKNYNAEDLMNVNEFSQNRGNNRVNFAPPLNEIELDNFQIAVYEELVHELF
H
NT seq 2526 nt NT seq  +upstreamnt  +downstreamnt
atggacctcccaactgttaatagcacaacaagcatttccgacaatgtggatttaaagaac
tactatgaggacttgcttttcaagaataacagcggaaaatcgctatccgatttaccccgt
aaactgaatgataactccaataattcaggaagtgatacggttgatccgcttgctggcctg
aataatttgagaaactcaataaaaagtgcgggaaatggtatggaaaacaggaggactttt
gacgatattgattttatgggtaggtttccgtatttgccaccagtgccaaatcaacaacag
caaccgttttctcaccagaacgggttcattcaagaacacccttccagtaatttgacctct
tttcaaatgtcttcgtctaattcagagccgatgtccgcaccgcccatttcatccaataac
aataatttaaactctactcaaatgggtaattatcaagctcaacaacggtcgttcccgcaa
tttaatggaaattcatttcattcaaatggaaacgacctaatggggaatcggatggattca
gactacatgcgtttaatgaataaaacaaacataggttttacttccaatagcggcagcaat
tttgctgccccatcacacagtgctggcaacccatctagtatgaacaaccaacaagtacca
tcatttaattggcaacagccatctcatccagagtctaccattaggagatcctcctacata
tcagatactctaatcaaccatcaaatgcctgacgctcggcaaaagcaaacatcccaagtg
cagcagcaacacgctcaaggtttcaatcttttcaatagcagattcaactatgacaacttg
aactcaacccatttgaccgccaaaggtgtgcccgagtttggaaatggtgtacaacctccg
tatccttatgataacgagcctaataatgccagtatcagcaatagtaataacaacaacaac
agtcacaatatggttccaatgcaacagtttcgccggaatacacaaccggtagcgagcttc
aatccatcccttcctacttttcaacaacaacagcaacaaccacaacaaccacaacaacca
agaaacgttaatgtacctacttctttcaatggcgaacgtgttgatgatgttcagcttgtt
caacttcaaagaagcagttctgtcccttcttctacaaactcacataaccttcagaacgag
aacagcaatgaaggaaatgtatctttggacaatggtttagttttaattcagggtaaacac
ttgacttcgtccaaaaccttacacgatttatacagcgactgtggcagcggctattttgct
agctctgcagtttttgaattcacagataatattaagaaaatgctgaagttgcacgattct
aatgaaagttacgacgcgaagaacatgggcttaatcgatgaagaaggtaatacataccaa
tctttattaaatttcttggacattttaagaagttgcaacatgaattacgttaatgatcca
gagtcgaataatggaattgtttccaataatggaggcaataaaaataggaggaagggctct
ttcacaacagaactatcatgcaggaatgctaataactcctttttaccttatacaccattg
gtactggttgctttgaaaaatgggaaacttgaactactatctactccacaagctaccaat
ttgttgttaaagagaggtgacttggttattattgatggtgaccgtggaagggatttagta
ttggttgttgagccctctgtcgatttgaatttagcattatttataaattttctgaaaaag
aaaattcactttgactctttaattacaagtgagtcacagcactatcgcaatgatgagttt
attcaaatgttgattgactcaaaaaatgggcaaaagaaaaaattaaatcccaaattgtat
gatgttgttgaattaactgagttaatcataccatctaaacaagtcttacgttttgccacc
ccgtgggaggtaacaacgaatttgcacaataaatttgaagatgaattaaaagccttgcat
attgctcagagtaaattacaagcgttaaatgataattcaaaatctcaaaatacaaatgac
agttcttccaataattttacgaatgctgcaacttattcaaagcctaaattgaatatcaag
attttaaacgcagaattccaatttgatagaaagaaattaacgttttactacgtttgtgag
gagagaaatgattttagagacttgataaaagagctgttcaaatattacaagacaagaatt
tggttgtgtgccatcccgaataatctgtctattgattctaagtattatgataaacaacaa
aaagagctgaaattatatcaaaacatagtaaaaaattacaatgctgaagatttaatgaat
gtcaatgagttttcgcagaacagggggaataacagagttaattttgcacctccgttgaac
gaaattgaactcgacaactttcagattgctgtgtatgaagaattagttcacgaattattt
cattaa

DBGET integrated database retrieval system