KEGG   Saccharomyces cerevisiae (budding yeast): YDR508CHelp
Entry
YDR508C           CDS       T00005                                 

Gene name
GNP1
Definition
(RefSeq) glutamine permease GNP1
  KO
K16261  yeast amino acid transporter
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Brite
KEGG Orthology (KO) [BR:sce00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:sce02000]
    YDR508C (GNP1)
Transporters [BR:sce02000]
 Other Transporters
  Electrochemical potential-driven transporters [TC:2]
   YDR508C (GNP1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_permease AA_permease_2
Motif
Other DBs
NCBI-GeneID: 852121
NCBI-ProteinID: NP_010796
SGD: S000002916
UniProt: P48813
Position
IV:complement(1466453..1468444)
Genome map
AA seq 663 aa AA seqDB search
MTLGNRRHGRNNEGSSNMNMNRNDLDDVSHYEMKEIQPKEKQIGSIEPENEVEYFEKTVE
KTIENMEYEGEHHASYLRRFIDSFRRAEGSHANSPDSSNSNGTTPISTKDSSSQLDNELN
RKSSYITVDGIKQSPQEQEQKQENLKKSIKPRHTVMMSLGTGIGTGLLVGNSKVLNNAGP
GGLIIGYAIMGSCVYCIIQACGELAVIYSDLIGGFNTYPLFLVDPALGFSVAWLFCLQWL
CVCPLELVTASMTIKYWTTSVNPDVFVVIFYVLIVVINVFGAKGYAEADFFFNCCKILMI
VGFFILAIIIDCGGAGTDGYIGSKYWRDPGAFRGDTPIQRFKGVVATFVTAAFAFGMSEQ
LAMTASEQSNPRKAIPSAAKKMIYRILFVFLASLTLVGFLVPYTSDQLLGAAGSATKASP
YVIAVSSHGVRVVPHFINAVILLSVLSVANGAFYTSSRILMSLAKQGNAPKCFDYIDREG
RPAAAMLVSALFGVIAFCASSKKEEDVFTWLLAISGLSQLFTWITICLSHIRFRRAMKVQ
GRSLGEVGYKSQVGVWGSAYAVLMMVLALIAQFWVAIAPIGGGGKLSAQSFFENYLAMPI
WIALYIFYKVWKKDWSLFIPADKVDLVSHRNIFDEELLKQEDEEYKERLRNGPYWKRVLD
FWC
NT seq 1992 nt NT seq  +upstreamnt  +downstreamnt
atgacgcttggtaatagacgccatgggcggaataatgagggaagctctaatatgaatatg
aatcgtaacgaccttgacgatgtttcccattacgagatgaaggaaatacaaccaaaggaa
aaacaaattggctctatagaaccggaaaatgaagtagaatattttgaaaaaacagtggaa
aaaaccattgaaaatatggaatatgaaggtgaacatcatgcatcttacttacggaggttc
attgactcgtttagaagagcggaaggctcgcatgcaaattccccagactcgagcaactct
aatgggactactcctatatccacaaaagattccagctctcaattggacaatgagttgaat
cggaagagctcatacatcactgttgatggtattaaacagtcaccacaagaacaagaacag
aaacaagaaaatttgaaaaagagtataaagccccgtcatacggtgatgatgtccctaggg
actggtattggtactggtttgctggtcggtaactccaaagttttgaacaatgcaggtccg
ggtggtttgatcattggttatgctattatgggtagttgtgtttactgtattattcaagct
tgtggtgaattagcggttatatacagtgatttgattggtggatttaatacatatcctttg
tttttggtcgaccctgcacttggcttttctgttgcttggcttttttgcttacaatggcta
tgtgtttgtcctctagaattggtcactgcatccatgactatcaaatattggacgacatct
gtgaacccggatgttttcgttgttatcttctacgtactaatcgttgttatcaacgttttt
ggagctaagggttatgcagaggcagatttcttcttcaattgttgtaaaattctgatgata
gttggatttttcattctcgccattattattgattgtggtggtgcaggtaccgatggttac
ataggtagcaaatattggcgtgatcccggagccttccgtggtgatacacccatccagagg
ttcaaaggtgtcgttgccacatttgtcacagcagcgttcgcctttggtatgagtgaacag
ctggctatgactgccagtgaacaatccaatccaagaaaggctattccatcggcggcaaag
aaaatgatttatagaattctgtttgtgttcttggcgtctttaacgttagttggtttcctt
gtaccttacacctcagatcaattgctaggggccgcaggttcagccactaaagcgtcgccc
tacgtcatcgctgtctcctctcatggtgttcgtgtggttcctcatttcataaacgctgtc
atcctgttgtctgttctttccgttgctaacggtgccttctataccagttctcgtattttg
atgtcgttggccaaacaaggtaatgcacccaaatgtttcgattacatcgatagggaaggt
agacctgctgctgctatgcttgtcagtgcattatttggtgtcattgcattctgtgcctca
tctaaaaaggaagaggacgttttcacctggttgttagcaatctccggtttgtctcaatta
ttcacgtggattaccatttgtttgtctcacattaggtttagaagagctatgaaagtgcaa
ggaaggtccttaggagaggttggttataaatctcaagtcggtgtctgggggtcggcttac
gctgtccttatgatggtgttagctttaatcgcccaattttgggttgccattgccccaatt
ggtggaggaggtaagttaagtgcccaatcattttttgagaattatttggctatgccaatc
tggattgctttatacatcttttacaaagtttggaaaaaagattggagtttattcattccc
gctgataaagtagacttagtttctcatagaaacatctttgatgaagaattattaaaacaa
gaagatgaagaatataaagagagattaagaaacggaccatactggaaaagagttcttgat
ttctggtgttaa

DBGET integrated database retrieval system