KEGG   Saccharomyces cerevisiae (budding yeast): YDR510W
Entry
YDR510W           CDS       T00005                                 

Gene name
SMT3
Definition
(RefSeq) SUMO family protein SMT3
Organism
sce  Saccharomyces cerevisiae (budding yeast)
SSDB
Motif
Pfam: Rad60-SLD ubiquitin SRP9-21 Vasohibin
Other DBs
NCBI-GeneID: 852122
NCBI-ProteinID: NP_010798
SGD: S000002918
UniProt: Q12306
Structure
PDB: 

Position
IV:1469400..1469705
AA seq 101 aa
MSDSEVNQEAKPEVKPEVKPETHINLKVSDGSSEIFFKIKKTTPLRRLMEAFAKRQGKEM
DSLRFLYDGIRIQADQTPEDLDMEDNDIIEAHREQIGGATY
NT seq 306 nt   +upstreamnt  +downstreamnt
atgtcggactcagaagtcaatcaagaagctaagccagaggtcaagccagaagtcaagcct
gagactcacatcaatttaaaggtgtccgatggatcttcagagatcttcttcaagatcaaa
aagaccactcctttaagaaggctgatggaagcgttcgctaaaagacagggtaaggaaatg
gactccttaagattcttgtacgacggtattagaattcaagctgatcagacccctgaagat
ttggacatggaggataacgatattattgaggctcacagagaacagattggtggtgctacg
tattag

DBGET integrated database retrieval system