KEGG   Saccharomyces cerevisiae (budding yeast): YDR510WHelp
Entry
YDR510W           CDS       T00005                                 

Gene name
SMT3
Definition
(RefSeq) SUMO family protein SMT3
  KO
K12160  small ubiquitin-related modifier
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce03013  RNA transport
Brite
KEGG Orthology (KO) [BR:sce00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    YDR510W (SMT3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:sce03019]
    YDR510W (SMT3)
   04121 Ubiquitin system [BR:sce04121]
    YDR510W (SMT3)
   03029 Mitochondrial biogenesis [BR:sce03029]
    YDR510W (SMT3)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:sce04812]
    YDR510W (SMT3)
Messenger RNA biogenesis [BR:sce03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    Nuclear pore complex
     YDR510W (SMT3)
Ubiquitin system [BR:sce04121]
 Ubiquitins and Ubiquitin-like proteins
  Ubiquitin-like proteins (UBLs)
   YDR510W (SMT3)
Mitochondrial biogenesis [BR:sce03029]
 Mitochondrial quality control factors
  Mitochondrial dynamics
   Fission and Fusion factors
    YDR510W (SMT3)
Cytoskeleton proteins [BR:sce04812]
 Eukaryotic cytoskeleton proteins
  Septins
   Septin associated proteins
    YDR510W (SMT3)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Rad60-SLD ubiquitin SRP9-21
Motif
Other DBs
NCBI-GeneID: 852122
NCBI-ProteinID: NP_010798
SGD: S000002918
UniProt: Q12306
Structure
PDB: 

Position
IV:1469400..1469705
Genome map
AA seq 101 aa AA seqDB search
MSDSEVNQEAKPEVKPEVKPETHINLKVSDGSSEIFFKIKKTTPLRRLMEAFAKRQGKEM
DSLRFLYDGIRIQADQTPEDLDMEDNDIIEAHREQIGGATY
NT seq 306 nt NT seq  +upstreamnt  +downstreamnt
atgtcggactcagaagtcaatcaagaagctaagccagaggtcaagccagaagtcaagcct
gagactcacatcaatttaaaggtgtccgatggatcttcagagatcttcttcaagatcaaa
aagaccactcctttaagaaggctgatggaagcgttcgctaaaagacagggtaaggaaatg
gactccttaagattcttgtacgacggtattagaattcaagctgatcagacccctgaagat
ttggacatggaggataacgatattattgaggctcacagagaacagattggtggtgctacg
tattag

DBGET integrated database retrieval system