KEGG   Saccharomyces cerevisiae (budding yeast): YDR514CHelp
Entry
YDR514C           CDS       T00005                                 

Definition
(RefSeq) hypothetical protein
Organism
sce  Saccharomyces cerevisiae (budding yeast)
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-GeneID: 852126
NCBI-ProteinID: NP_010802
SGD: S000002922
UniProt: Q04408
Position
IV:complement(1471548..1472999)
Genome map
AA seq 483 aa AA seqDB search
MSSSTKCKKAYEAVVKMVTHRFNSKAVRNYHQPQGLNRSLATRNAARVRGMVPSRRGGVG
LYKSSSSKLMNKLGRQKTWINEFEHFNSLHEIAYTPNIALSSEIQKYLKALETNYRSIYE
KSSELLDKKLEEIDKKWIEKNGCIPDASKDDVEKNLRKQYLADVQDVKNEHIPVMNCEPG
GSQFKYLCKTIELLSSNKTICFAIDVEAFEFDTDIVTEIGIAIYDPRENIYSLMPIIRSY
HLIVAEALPLRNKKFVCDFKDCFLLGESLVLPLEQCVEFIQSLINFYMKCETDQDTTWER
AFVGHAIAGDIKWLKKIGVHVPELDNELTKPEDSTESKGVRKHVKMLDTEKIYSMCYGKK
GSSLGKLLRLFHLPHAFLHNAGNDAYYTLLLMLKLGDYNFRKQIGADDLETMGYRIREWF
KREADEPKILPMSYVLSVMNANNSKPKVDDKGRKKPRDLVPQTEFSGSHWFQNARAAFKS
TLV
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
atgagtagctccacaaagtgcaagaaagcatacgaagcggtagtcaaaatggttacgcat
agattcaactccaaagcagtccgcaattaccatcaaccacaaggtttaaacaggagtctg
gcaacccgcaatgcagctagagttaggggtatggtcccttcaagaagagggggcgtggga
ctgtataagagttcaagtagcaagttgatgaataaactaggaagacaaaagacatggata
aatgagtttgaacattttaattctctgcacgaaattgcatatacccctaacattgcgtta
agtagtgaaatccaaaaatatttaaaggcattggaaacaaactatcggtccatctatgag
aaaagttcagaattactggataagaagctggaagaaattgacaagaaatggatagagaaa
aacgggtgtatacctgatgcatctaaagacgatgtggagaaaaatctaagaaagcaatat
ttagcagatgtacaggacgtaaaaaacgaacatatacctgtgatgaattgtgaacctggt
gggtctcagttcaagtatctctgtaaaactattgagttattatcatccaacaagacaatt
tgttttgccatcgatgtagaggcatttgaatttgatacagacattgttacagagattggc
atcgccatatatgatccaagagaaaacatttattccttgatgccgattataagaagttat
catttaattgttgctgaagcgttaccgttaagaaacaagaaattcgtatgcgactttaaa
gactgctttttacttggagaaagtcttgtattaccattggaacaatgtgtagagttcatt
cagtcgttgattaatttctatatgaaatgtgagacggaccaagatacaacctgggaaaga
gcgtttgtgggtcatgctatagcgggggatattaagtggctgaagaaaattggggtccat
gtacctgaattggataatgaacttaccaaaccggaggactcaacggagagcaaaggtgtt
agaaaacatgttaagatgcttgacacagagaaaatttatagcatgtgttatggcaagaag
ggtagcagtttaggtaaactactaaggctttttcacttgccacatgccttcttacataac
gcaggcaatgatgcatattacacgttgctcctgatgctgaagttaggagattataacttt
agaaagcaaattggggcagatgatttagaaacaatgggatataggataagagaatggttt
aagcgtgaggcggacgaacccaaaattttgccaatgtcgtacgtgctaagtgtgatgaat
gccaataatagcaaaccgaaagttgatgataagggaagaaagaagccgagggatcttgta
cctcagacggaatttagcgggtctcattggtttcaaaatgcacgcgcagccttcaaaagt
actcttgtgtga

DBGET integrated database retrieval system