KEGG   Saccharomyces cerevisiae (budding yeast): YDR515WHelp
Entry
YDR515W           CDS       T00005                                 

Gene name
SLF1, SRO99
Definition
(RefSeq) Slf1p
Organism
sce  Saccharomyces cerevisiae (budding yeast)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: La
Motif
Other DBs
NCBI-GeneID: 852127
NCBI-ProteinID: NP_010803
SGD: S000002923
UniProt: Q12034
Position
IV:1473429..1474772
Genome map
AA seq 447 aa AA seqDB search
MSSQNLNDNPKNTSSAAEDKKKQTSSLKLAPIPTTSPWKSSSPDSNTVIPVEELRDISKT
AKPSKNGSGSIKLTSNTKWTPITPSVIISGSKDTNSKSGKNSKNSKTNKKMKKRGKYNND
INKKDFNGQTNSTSEISNVSNLESKPLDANAKVNIHSSSGATANGNIKRITNNNNSTNGR
QSRNYQNRNGKTRYNNNSRHSQAANNAISFPNNYQARPEYIPNASHWLNNNSRNSYKQLS
YFRQQQYYNNINYQQQLQTPYYYSMEPIFKSIESIKNQIEFYFSEENLKTDEFLRSKFKK
ANDGFIPMSLIGKFYRMVNLSLGGDPNLILASMREVLQHKETNHLEIALGSIEGAQKNMA
DDFNPLENYFIRRENWAEYAMESNFDENDDETEKYNIEKLLGPNDLDNYSYMGYPNFFPS
NENGKKSQSYDQGEISRQFEQNLQIND
NT seq 1344 nt NT seq  +upstreamnt  +downstreamnt
atgtcatcgcaaaacctcaatgataatccaaaaaatacatcctcagcagctgaagataag
aagaaacaaacttcatccttaaagttggcaccaataccaaccacatcgccatggaaatca
tcttcgccagatagcaatacagtaattcctgtagaggaactaagagatatatcaaagact
gcaaagccaagtaaaaatggttcggggtcaattaaattaacaagcaataccaaatggact
ccaattacgccgtctgttataatctcaggttccaaggacacaaattcaaagtcaggaaag
aactctaaaaattctaagactaataaaaaaatgaaaaagcgtggcaaatataataacgat
atcaataaaaaggactttaacggtcaaaccaacagtacatcggaaataagtaacgtttcc
aatcttgaatccaaacctttagatgctaacgctaaagtaaacatacattcaagctcagga
gcaactgccaatgggaatataaagaggataacaaacaacaacaattcaaccaacggtaga
caatcaagaaattatcaaaacaggaatggcaaaacaagatacaacaacaatagtagacac
agtcaggcggctaataatgccatctccttcccaaataattatcaggctagacctgaatat
attcccaatgccagccactggttgaacaacaattcaagaaatagctataaacaactgtca
tacttccgtcaacagcagtattataataacatcaactatcaacaacaattgcaaacacca
tattattactcaatggaacctatttttaaatctatcgaaagtatcaaaaaccaaattgaa
ttctattttagtgaagagaacttgaaaacagatgaatttttaagatctaaattcaaaaaa
gccaatgacggatttatccccatgagtttgatagggaaattttaccgtatggttaattta
tctcttggtggagacccaaatttaattttggcatctatgagagaagttttacaacataaa
gaaacaaaccatttggaaattgcccttggaagcatagaaggtgctcagaagaacatggca
gatgatttcaatccattggaaaactattttattaggcgcgaaaattgggctgaatacgct
atggaaagtaattttgatgaaaatgatgacgaaactgaaaaatacaacattgagaaacta
ttgggaccgaacgatttagacaattattcttatatgggctatccaaacttctttcccagt
aatgaaaatgggaaaaagagtcagagctatgaccaaggtgaaattagcaggcagtttgaa
caaaacttacaaataaatgattaa

DBGET integrated database retrieval system