KEGG   Saccharomyces cerevisiae (budding yeast): YDR517WHelp
Entry
YDR517W           CDS       T00005                                 

Gene name
GRH1
Definition
(RefSeq) Grh1p
Organism
sce  Saccharomyces cerevisiae (budding yeast)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GRASP55_65
Motif
Other DBs
NCBI-GeneID: 852129
NCBI-ProteinID: NP_010805
SGD: S000002925
UniProt: Q04410
Position
IV:1477239..1478357
Genome map
AA seq 372 aa AA seqDB search
MFRIAKNLVRTFEQSVQDTLALSQDSSNLDAFFQSIPPNLLSAQLESPVDAVSEGVKHTN
VNETLSGLRIVWVDEMQFQLQSFFDYIVGFNDDPVPVVSNQHGFSYPDYRRITSIFNEHC
GRTLKVNIWSAKGGTFRDEYISIISKESDDLDDVSLNHDERRPSSGEAHQFQALGFKVQW
TPLIASTFTYHILNVNIPDGPAQSAGLIPDEDYIIGCQDGLLATGGETLLQDIVRSRANY
DLVLYVYNKVSDCVRPITVHIGPDGRLGCNVGYGFLHRIPTVKHCPQQAQQQGQDDNPVP
VPVPVESETAFVPSAFTAPPVPTKKKSKNKKGTQPLAMDDYFNEGRDKSSTAAKSAESDI
LAPPPQKQSSSD
NT seq 1119 nt NT seq  +upstreamnt  +downstreamnt
atgtttagaatagctaaaaacctcgtacggacttttgagcagagcgtgcaagataccctg
gcactctcgcaggactcgagcaatctggacgctttctttcagtctataccaccaaatttg
ttgtctgctcagttggaatcacccgtagatgcggtttctgaaggtgttaagcacaccaac
gtcaatgaaacgctttccggtctccgcattgtttgggtggacgagatgcagttccaactg
cagtcctttttcgactatatagtaggtttcaatgatgatccggtgccggtggtcagtaat
caacacggattttcgtacccagattaccgtcgtatcacatccatcttcaatgaacactgt
ggccgaactttgaaggtcaacatatggtcagctaaaggaggcacgttcagagacgagtat
atcagcattatatcgaaggagagcgacgatttggacgatgtttctctaaaccatgacgag
aggaggccatctagtggggaagcgcaccagttccaagcactcgggttcaaagtccaatgg
acgcctttgatagcttccactttcacataccatatcctgaacgtgaacatcccagatgga
cccgcccaatcggcagggctcatcccagatgaagactacattatcggctgccaagatggc
ctgttggccacgggaggggagacgcttttacaagatattgttagatcaagagcaaactac
gatctggtcctttatgtctacaacaaagtttctgactgtgtgagaccaatcacagttcat
ataggtcccgacggcaggttgggttgcaacgttggatacgggtttcttcacaggattcca
acagtaaagcactgtccacaacaagcacagcagcaggggcaagatgacaaccctgttcct
gttcctgttccagtagaatctgagacggcttttgtgccatcagcattcacagcaccaccg
gtgccaacaaagaagaaatcaaaaaataaaaagggtacccagccattggcaatggatgac
tattttaatgaaggcagagataagtcatctaccgctgcgaagtcagcagaatctgacatc
ctcgccccaccaccacaaaaacagtcatcctctgattaa

DBGET integrated database retrieval system