KEGG   Saccharomyces cerevisiae (budding yeast): YDR518WHelp
Entry
YDR518W           CDS       T00005                                 

Gene name
EUG1
Definition
(RefSeq) protein disulfide isomerase EUG1
  KO
K09580  protein disulfide-isomerase A1 [EC:5.3.4.1]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:sce00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    YDR518W (EUG1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:sce03110]
    YDR518W (EUG1)
   04131 Membrane trafficking [BR:sce04131]
    YDR518W (EUG1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sce04147]
    YDR518W (EUG1)
Enzymes [BR:sce01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     YDR518W (EUG1)
Chaperones and folding catalysts [BR:sce03110]
 Protein folding catalysts
  Protein disulfide isomerase
   YDR518W (EUG1)
Membrane trafficking [BR:sce04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   PDI family proteins
    YDR518W (EUG1)
Exosome [BR:sce04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   YDR518W (EUG1)
  Exosomal proteins of colorectal cancer cells
   YDR518W (EUG1)
  Exosomal proteins of bladder cancer cells
   YDR518W (EUG1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thioredoxin Thioredoxin_6 Thioredoxin_7
Motif
Other DBs
NCBI-GeneID: 852130
NCBI-ProteinID: NP_010806
SGD: S000002926
UniProt: P32474
Position
IV:1478608..1480161
Genome map
AA seq 517 aa AA seqDB search
MQVTTRFISAIVSFCLFASFTLAENSARATPGSDLLVLTEKKFKSFIESHPLVLVEFFAP
WCLHSQILRPHLEEAASILKEHNVPVVQIDCEANSMVCLQQTINTYPTLKIFKNGRIFDG
QVYRGVKITDEITQYMIQLYEASVIYLNSEDEIQPYLENATLPVVINRGLTGLNETYQEV
ALDLAEDYVFLSLLDSEDKSLSIHLPNTTEPILFDGNVDSLVGNSVALTQWLKVVILPYF
TDIEPDLFPKYISSNLPLAYFFYTSEEELEDYTDLFTQLGKENRGQINFIALNSTMFPHH
VRFLNMREQFPLFAIHNMINNLKYGLPQLPEEEYAKLEKPQPLDRDMIVQLVKDYREGTA
KPIVKSEEIPKEQKSNVYKIVGKTHDDIVHDDDKDVLVKYYATWCIHSKRFAPIYEEIAN
VLASDESVRDKILIAEVDSGANDILSFPVTGYPTIALYPAGNNSKPIIFNKIRNLEDVFE
FIKESGTHHIDGQAIYDKLHQAKDSEVSTEDTVHDEL
NT seq 1554 nt NT seq  +upstreamnt  +downstreamnt
atgcaagtgaccacaagatttatatctgcgatagtctcgttttgcctgtttgcttctttc
acgttggctgaaaacagcgcaagagctacgccgggatcagatttactcgttctaacagag
aagaaatttaaatcattcatcgaatctcatccgttagtcctcgtcgagttttttgctcca
tggtgtttgcattctcagatcttacgccctcacttagaagaggccgcctctattttaaag
gagcataacgtcccagttgttcaaattgattgtgaggctaacagtatggtttgcctgcaa
caaactataaatacctacccaaccttgaaaatctttaaaaatggtcgtatttttgatggt
caagtctatcgcggtgtcaagatcaccgatgaaatcactcagtacatgattcagctatac
gaggcttctgtcatttatttaaattccgaagatgaaatccaaccatacttggaaaatgca
actttaccagtagtaataaacagaggcttgacaggcttgaatgaaacgtatcaagaagtc
gcactggaccttgctgaggattacgtctttttatcccttctagattcagaagataagtca
ttatcaatccacttgccaaacactacagaaccaattctgtttgatggaaatgtagactct
ttggtcggaaattccgttgctctaactcagtggttaaaagtggtaattttaccttacttt
accgacatcgaacctgatctcttccccaagtacatttctagcaatttgccgttggcttac
ttcttttatacttctgaggaagaattggaagattacactgatcttttcacgcagttaggt
aaggaaaatcgtggccaaataaatttcattgcattaaactctacaatgttcccacaccac
gttagattcctaaatatgagagaacagttcccattatttgctatccataatatgatcaat
aatctgaaatatggtttaccacaactaccagaagaagagtacgcgaaattagaaaaacca
caaccactagacagagatatgatcgttcagttggtaaaagattaccgtgaaggtactgcc
aagccaattgttaagtcagaagagattccaaaagaacaaaagtccaatgtttataaaata
gttgggaagacacatgacgacattgttcatgatgatgacaaggatgtccttgtcaaatat
tacgcgacatggtgtattcatagtaaaaggtttgcgcctatttacgaagaaattgcaaat
gtcttagcatctgatgaatctgttcgcgataaaatcttgatcgccgaagtagattcaggg
gcaaatgatatcttaagttttcctgtgacaggatatccaaccattgctttgtatcctgcc
ggaaataactctaagcctattatcttcaataaaattagaaatttggaagatgttttcgaa
tttatcaaggaatcaggtacacatcacattgacggccaggcaatttatgataaattgcac
caggccaaggattctgaagtgtctactgaagataccgtacatgatgaattataa

DBGET integrated database retrieval system