KEGG   Saccharomyces cerevisiae (budding yeast): YEL006W
Entry
YEL006W           CDS       T00005                                 

Gene name
YEA6, NDT2
Definition
(RefSeq) NAD+ transporter
  KO
K15115  solute carrier family 25 (mitochondrial folate transporter), member 32
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Brite
KEGG Orthology (KO) [BR:sce00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:sce02000]
    YEL006W (YEA6)
Transporters [BR:sce02000]
 Solute carrier family (SLC)
  SLC25: Mitochondrial carrier
   YEL006W (YEA6)
SSDB
Motif
Pfam: Mito_carr
Other DBs
NCBI-GeneID: 856712
NCBI-ProteinID: NP_010910
SGD: S000000732
UniProt: P39953
Position
V:144327..145334
AA seq 335 aa
MNNGDNKTTLENSKNASLANGNYAIPTKLNRLKKNADPRVAAISGALSGALSAMLVCPFD
VAKTRLQAQGLQNMTHQSQHYKGFFGTFATIFKDEGAAGLYKGLQPTVLGYIPTLMIYFS
VYDFCRKYSVDIFPHSPFLSNASSAITAGAISTVATNPIWVVKTRLMLQTGIGKYSTHYK
GTIDTFRKIIQQEGAKALYAGLVPALLGMLNVAIQFPLYENLKIRFGYSESTDVSTDVTS
SNFQKLILASMLSKMVASTVTYPHEILRTRMQLKSDLPNTVQRHLLPLIKITYRQEGFAG
FYSGFATNLVRTVPAAVVTLVSFEYSKKYLTTFFQ
NT seq 1008 nt   +upstreamnt  +downstreamnt
atgaataatggagacaataaaacgacattagaaaactcaaaaaatgcgtcactagctaat
ggaaattatgcgattcccacaaaactaaataggctgaaaaagaatgctgaccctagagtt
gctgcaatttcaggtgctttatctggtgcactatccgcaatgctggtctgtccttttgac
gttgcgaaaacaagattacaagcacaaggtctccaaaacatgacacaccaaagtcaacat
tataaggggttttttggtacatttgctactattttcaaggatgaaggtgctgctgggctt
tataaaggtctacagccgacggttttaggttatattcctactttgatgatttacttttcc
gtctatgatttctgtagaaaatattcggtcgatattttcccacatagtccgtttctctca
aacgcttcttctgcaattactgcaggtgccatctctacagttgcgacaaatccgatttgg
gtagtaaaaacaagacttatgctgcaaacaggtatcggtaaatattccacccattataag
ggtaccatagacacatttagaaagatcattcaacaagagggtgctaaggctctttatgcc
ggcttagtaccagccctgctggggatgctgaacgttgctatacagtttcctttatatgaa
aatttaaaaataaggttcggatattcagaatcgactgacgtatcgacagatgtgacgagc
tcaaactttcaaaaattaatattggcctctatgctatctaaaatggtagcatctaccgtg
acttatcctcacgaaatacttcgaactcgaatgcaactgaaatccgatcttccaaatact
gttcaacgccatctccttccattgattaaaattacgtataggcaagagggcttcgccggc
ttttactctgggtttgcaactaatttggtaaggacagtacctgctgctgtggtaacacta
gtatcgtttgaatattctaaaaagtatttaactactttttttcaataa

DBGET integrated database retrieval system