KEGG   Saccharomyces cerevisiae (budding yeast): YEL017C-A
Entry
YEL017C-A         CDS       T00005                                 

Gene name
PMP2
Definition
(RefSeq) proteolipid ATPase
Organism
sce  Saccharomyces cerevisiae (budding yeast)
SSDB
Motif
Pfam: PMP1_2 Cytochrom_B558a CD34_antigen
Other DBs
NCBI-GeneID: 856697
NCBI-ProteinID: NP_010898
SGD: S000002103
UniProt: P40975
Position
V:complement(122798..122929)
AA seq 43 aa
MLMSTLPGGVILVFILVGLACIAIISTIIYRKWQARQRGLQRF
NT seq 132 nt   +upstreamnt  +downstreamnt
atgttgatgagcacgttaccaggtggtgttatcttagtttttattctagtcggtttggct
tgtatcgccatcatttctaccattatctacagaaaatggcaagctagacaaagaggttta
caaagattctaa

DBGET integrated database retrieval system