KEGG   Saccharomyces cerevisiae (budding yeast): YEL017W
Entry
YEL017W           CDS       T00005                                 

Gene name
GTT3
Definition
(RefSeq) Gtt3p
Organism
sce  Saccharomyces cerevisiae (budding yeast)
SSDB
Motif
Pfam: Serglycin Glypican SURF6
Other DBs
NCBI-GeneID: 856698
NCBI-ProteinID: NP_010899
SGD: S000000743
UniProt: P39996
Position
V:123657..124670
AA seq 337 aa
MPTKSTFSRWKKADLIDLANKLEIDGFPNYAKKSDMIDYLESHLNHLEKPVDFKDDYPEL
RSFYESMTVDQSKDERNEYGSGSGNGSGSGSCDTATNDSDLEKAYIKEDDDEKPQSGDET
SATKPLSSRNANSNAKTNFNLLDFSTDNDSSTSAFTKFKFNFQEYLSDIRYQTQKLNENV
QDYLSTISAVDTIFSLLEFSFLVRNILAAGQPTSSSSLASSLEAAVAAHNKYQYTLDFCL
PILTWLLFFRGIPTLVSYYINFIRYDLNIELDPMTFNLTKFLISLAIFKTCNNKNIDFHS
FRCVNQLWTQLCTVNRSLGMVPLVFSMVSCLLTLYVL
NT seq 1014 nt   +upstreamnt  +downstreamnt
atgccgaccaagtcaacttttagtcgctggaagaaggcggacctaattgacctggccaac
aagctggaaattgacggcttccccaattatgccaagaagagtgatatgatcgattacctc
gaatcgcacttgaatcatcttgagaaacctgtggattttaaagacgactacccggaacta
aggtccttttatgagtcgatgacagtggaccagtcaaaggatgaacggaacgaatacgga
tccggatctggaaacgggtctgggtctggatcctgtgacaccgccacaaatgattccgat
ctggagaaagcgtacatcaaggaggatgatgatgagaaaccgcaatcaggcgatgaaaca
agcgcgacaaagccgctttccagcaggaatgcaaattcaaacgccaaaacgaacttcaat
ttgttggattttagcacagataacgactcgtccacctctgcgtttactaagttcaagttt
aactttcaggaatacctctccgatattagataccaaacgcagaaattgaatgaaaatgtt
caggactatctttccactatttccgccgtcgatacgattttttccttgttggaattctct
tttctggtgagaaacatattagccgccgggcagccaacttcttcttcttcgctcgcatcg
tcgctggaagccgccgttgccgcccataataaatatcaatacacgctcgatttctgttta
ccaatactcacgtggctgctcttctttaggggtattccaacgttagtgtcatactacatc
aacttcatccgctacgacctgaacatcgagttggacccgatgactttcaatctcacgaaa
ttcttgatttctttggcaatcttcaaaacttgtaataataaaaacatagatttccattct
tttcgatgtgttaaccaactatggacacaactctgtacagtgaaccgttcccttggtatg
gtacctctagtattctccatggttagttgtctcctcactctatacgtattatag

DBGET integrated database retrieval system