KEGG   Saccharomyces cerevisiae (budding yeast): YEL018W
Entry
YEL018W           CDS       T00005                                 

Gene name
EAF5
Definition
(RefSeq) Eaf5p
  KO
K11398  chromatin modification-related protein EAF5
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Brite
KEGG Orthology (KO) [BR:sce00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:sce03036]
    YEL018W (EAF5)
Chromosome and associated proteins [BR:sce03036]
 Eukaryotic type
  Histone modification proteins
   HAT complexes
    NuA4 complex
     YEL018W (EAF5)
SSDB
Motif
Pfam: Bet_v_1 Med30
Other DBs
NCBI-GeneID: 856696
NCBI-ProteinID: NP_010897
SGD: S000000744
UniProt: P39995
Structure
PDB: 
5Y81

Position
V:121471..122310
AA seq 279 aa
MDKEVSELVVLQLIHTLISNKNEELVRNGGGINMIGNNLRISLVKLTNEIQNNLLINELT
NLRRQSNVANGNRKLGINDILTIVKNLFPEYRTTLNDGQLSLHGLEMHDIEKLLDEKYDR
FKKTQVEQIRMMEDEILKNGIKTGASQLQPHANAGKSGSAGTSATITTTTPHMAHSMDPK
REKLLKLYRDTVLNKLESKTGNFQKLFKSPDGSIIKNEINYEDIKNETPGSVHELQLILQ
KSITDGVMRKVIGTDDWKLARQVQFELDDTVQFMRRALE
NT seq 840 nt   +upstreamnt  +downstreamnt
atggataaagaggtaagtgaattggtagtgttgcagctaatacacactttaatttccaac
aagaatgaagaactggttaggaacgggggaggaatcaacatgattgggaataatcttcga
atatcgctagtcaagttgactaacgaaatacaaaacaatttgctaatcaacgagctgaca
aatttaagaaggcaaagcaacgtggcaaatggaaacaggaaactgggcatcaacgatatc
ctgaccatagttaagaatttattcccagagtacagaacaacactaaacgatggacaactt
agtctacacggtttggaaatgcatgatatcgagaagctccttgacgaaaagtacgatcga
ttcaagaaaacgcaggtcgaacaaataaggatgatggaggatgagatattgaagaacggt
ataaagaccggtgcatcgcaactgcaaccacatgcaaatgctggcaaaagtggatctgct
ggtaccagtgctactataactacgactacgccacacatggcgcattcaatggacccaaaa
agagaaaaactattgaaattatacagagataccgttctgaataaattggaaagtaaaact
gggaattttcagaagctattcaagagtcccgatggtagcattatcaagaatgagataaat
tacgaagacataaagaacgaaacgcccggcagcgttcatgaactgcagctgattcttcaa
aagagcataacggacggtgtaatgcgaaaggtcattggtacggacgactggaaattggct
agacaagtgcagtttgaattggatgatacggtgcagttcatgagaagagcactagagtaa

DBGET integrated database retrieval system