KEGG   Saccharomyces cerevisiae (budding yeast): YEL065W
Entry
YEL065W           CDS       T00005                                 
Symbol
SIT1, ARN3
Name
(RefSeq) siderophore transporter
  KO
K08197  MFS transporter, SIT family, siderophore-iron:H+ symporter
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Brite
KEGG Orthology (KO) [BR:sce00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:sce02000]
    YEL065W (SIT1)
Transporters [BR:sce02000]
 Major facilitator superfamily (MFS)
  Metal transporters
   Siderophore-iron transporter (SIT) family [TC:2.A.1.16]
    YEL065W (SIT1)
SSDB
Motif
Pfam: MFS_1 Sugar_tr
Other DBs
NCBI-GeneID: 856644
NCBI-ProteinID: NP_010849
SGD: S000000791
UniProt: P39980
Position
V:27657..29543
AA seq 628 aa
MDPGIANHTLPEEFEEVVVPEMLEKEVGAKVDVKPTLTTSSPAPSYIELIDPGVHNIEIY
AEMYNRPIYRVALFFSLFLIAYAYGLDGNIRYTFQAYATSSYSQHSLLSTVNCIKTVIAA
VGQIFFARLSDIFGRFSIMIVSIIFYSMGTIIESQAVNITRFAVGGCFYQLGLTGIILIL
EVIASDFSNLNWRLLALFIPALPFIINTWISGNVTSAIDANWKWGIGMWAFILPLACIPL
GICMLHMRYLARKHAKDRLKPEFEALNKLKWKSFCIDIAFWKLDIIGMLLITVFFGCVLV
PFTLAGGLKEEWKTAHIIVPEVIGWVVVLPLYMLWEIKYSRHPLTPWDLIQDRGIFFALL
IAFFINFNWYMQGDYMYTVLVVAVHESIKSATRITSLYSFVSVIVGTILGFILIKVRRTK
PFIIFGISCWIVSFGLLVHYRGDSGAHSGIIGSLCLLGFGAGSFTYVTQASIQASAKTHA
RMAVVTSLYLATYNIGSAFGSSVSGAVWTNILPKEISKRISDPTLAAQAYGSPFTFITTY
TWGTPERIALVMSYRYVQKILCIIGLVFCFPLLGCAFMLRNHKLTDSIALEGNDHLESKN
TFEIEEKEESFLKNKFFTHFTSSKDRKD
NT seq 1887 nt   +upstreamnt  +downstreamnt
atggaccctggtattgctaatcataccctccccgaggaatttgaagaggttgtcgttccc
gagatgctggaaaaggaagtaggagccaaggtcgatgtcaagccaacgctaaccacatct
tctccagcaccttcttacattgaattgatagatccaggtgtgcataacatcgagatttac
gcagaaatgtacaaccgcccgatctaccgtgtcgcattattcttctcacttttcctcatt
gcctatgcttacggattagatggtaatatccgttacactttccaggcgtacgcgacttcg
tcgtactcccagcactcgctgctatcgaccgtcaactgtattaagacggttattgcggct
gtaggccagatcttctttgccagattatcagatatcttcggcagattttccattatgatt
gtcagtatcattttttatagcatggggaccatcattgagtcgcaagcggtgaatattaca
agatttgcagttggtggttgtttttaccaattgggtcttaccggtattattctaattttg
gaagttattgcttctgacttttccaacttgaactggaggttgttagccttattcattcca
gctttaccatttatcatcaacacctggattagcgggaacgtaacaagtgccatagatgct
aattggaaatggggtattggtatgtgggcttttatactgccgctagcttgtattccgctt
ggaatttgtatgttgcacatgaggtatttagcaagaaagcatgctaaagatagattgaag
cccgagttcgaagcgctaaacaaattgaagtggaagtccttttgtatagacatcgcattt
tggaaattggatatcattggaatgttattaattactgtatttttcgggtgtgtattggtt
ccattcaccttagcgggtggtttgaaagaggaatggaaaactgcgcatattattgtccct
gaagtcattggttgggttgtagtgttaccactgtacatgctatgggaaataaagtactcg
agacatccattgacaccttgggacttgattcaagatagaggtatctttttcgctctactc
atcgcattctttatcaattttaactggtatatgcaaggtgattacatgtatactgtacta
gtcgttgcagttcatgaatccataaagtccgctacaagaattacctccttgtattcattt
gtttctgttatcgttggtacaatcctcgggttcatactgattaaagttagaaggactaag
ccttttattatatttggcatttcttgttggatcgtctcatttggtttgctggtccattac
cgtggtgactccggtgctcattccggtatcattggctctttgtgtctattaggtttcggt
gcaggttcatttacctatgtgactcaagcttccatccaagcatccgctaaaactcatgca
agaatggcggtagtaacctcattataccttgccacttataatattggttctgcatttggt
agttctgttagcggagctgtctggactaatatcctacccaaagaaatttcaaaaagaatt
tccgatccaaccttagctgcacaagcgtacggttctccatttacattcattacaacttat
acctggggaacaccagaaagaatagctttagtcatgtcttaccgctatgttcaaaagatt
ttatgtatcataggtttggtattctgctttcctttgttaggttgcgcattcatgttgaga
aatcataaactaacagattctattgctcttgaaggcaatgatcatttggaaagtaaaaac
acctttgaaattgaggaaaaggaagaaagttttttgaaaaataaattctttacgcacttt
acaagcagtaaagataggaaagattaa

DBGET integrated database retrieval system