KEGG   Saccharomyces cerevisiae (budding yeast): YEL071WHelp
Entry
YEL071W           CDS       T00005                                 

Gene name
DLD3
Definition
(RefSeq) D-lactate dehydrogenase
  KO
K21618  (R)-2-hydroxyglutarate---pyruvate transhydrogenase [EC:1.1.99.40]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce00620  Pyruvate metabolism
Brite
KEGG Orthology (KO) [BR:sce00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    YEL071W (DLD3)
Enzymes [BR:sce01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.99  With unknown physiological acceptors
    1.1.99.40  (R)-2-hydroxyglutarate---pyruvate transhydrogenase
     YEL071W (DLD3)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD-oxidase_C FAD_binding_4
Motif
Other DBs
NCBI-GeneID: 856638
NCBI-ProteinID: NP_010843
SGD: S000000797
UniProt: P39976
Position
V:16355..17845
Genome map
AA seq 496 aa AA seqDB search
MTAAHPVAQLTAEAYPKVKRNPNFKVLDSEDLAYFRSILSNDEILNSQAPEELASFNQDW
MKKYRGQSNLILLPNSTDKVSKIMKYCNDKKLAVVPQGGNTDLVGASVPVFDEIVLSLRN
MNKVRDFDPVSGTFKCDAGVVMRDAHQFLHDHDHIFPLDLPSRNNCQVGGVVSTNAGGLN
FLRYGSLHGNVLGLEVVLPNGEIISNINALRKDNTGYDLKQLFIGAEGTIGVVTGVSIVA
AAKPKALNAVFFGIENFDTVQKLFVKAKSELSEILSAFEFMDRGSIECTIEYLKDLPFPL
ENQHNFYVLIETSGSNKRHDDEKLTAFLKDTTDSKLISEGMMAKDKADFDRLWTWRKSVP
TACNSYGGMYKYDMSLQLKDLYSVSAAVTERLNAAGLIGDAPKPVVKSCGYGHVGDGNIH
LNIAVREFTKQIEDLLEPFVYEYIASKKGSISAEHGIGFHKKGKLHYTRSDIEIRFMKDI
KNHYDPNGILNPYKYI
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
atgacggccgcacatcctgttgctcagttaactgccgaggcataccctaaagtcaagaga
aacccaaatttcaaagttctcgactcggaagatttggcgtactttcgttcgattttgtca
aatgatgaaatcttaaactctcaagctccagaagagcttgcttcgtttaaccaggactgg
atgaaaaaatatagaggccagtccaatttaattctcttgccaaactccactgataaagtg
tccaagattatgaaatactgtaacgataaaaagttggcagtagtaccacaaggtggtaac
accgacttggtcggagcctctgttccggtatttgatgagattgttctttctctaagaaat
atgaacaaagtcagagattttgatccagttagcgggactttcaagtgtgacgcgggtgtc
gttatgcgtgatgcgcatcaatttttacacgaccatgaccatatcttcccattggatctg
ccttctagaaacaactgtcaagtgggcggtgtagtttcaacaaatgcaggtggtttgaac
tttttaagatatgggtctctacacggtaatgttttgggtttggaagtggtgctacccaac
ggtgagattatcagcaatatcaatgccctaaggaaggacaatactggttatgacttgaaa
caattattcatcggtgcagagggtactatcggtgtcgttactggtgtatccatagttgca
gcagcaaagccaaaagccttgaatgccgtattttttggtattgagaatttcgataccgtt
cagaaattatttgtcaaggctaaaagtgaattatctgagattttatctgcttttgaattc
atggaccgtggctccattgaatgtacgatagaatacttgaaggacttgcctttccctctg
gagaaccaacacaacttttatgttcttattgaaacgtcagggtccaataagagacacgac
gatgagaagctgactgctttcctcaaagataccacagattctaaattaatttcggagggt
atgatggctaaggacaaagccgattttgatagactttggacctggagaaaatctgttcca
acagcttgtaattcttacggtggtatgtacaagtatgacatgtcacttcaattgaaagat
ttatattccgtatctgcggctgtgacggagagattaaacgcagccggtttgattggtgat
gcaccaaaaccagttgttaaatcatgtggttatggtcatgtcggtgacggaaacatccat
ttaaatatcgcggtaagagaatttacaaaacagattgaggacttactagaaccatttgtt
tatgaatatattgcatcaaagaaaggttccatcagtgctgagcatgggatcggtttccat
aagaaaggtaagttacactacaccagaagtgatattgaaattagatttatgaaggatatc
aaaaatcactacgatccaaatggaatcttaaacccatacaagtacatttga

DBGET integrated database retrieval system