KEGG   Saccharomyces cerevisiae (budding yeast): YER013WHelp
Entry
YER013W           CDS       T00005                                 

Gene name
PRP22
Definition
(RefSeq) DEAH-box ATP-dependent RNA helicase PRP22
  KO
K12818  ATP-dependent RNA helicase DHX8/PRP22 [EC:3.6.4.13]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:sce00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    YER013W (PRP22)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:sce03041]
    YER013W (PRP22)
Enzymes [BR:sce01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     YER013W (PRP22)
Spliceosome [BR:sce03041]
 Complex C
  Other components
   Step II factors
    YER013W (PRP22)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HA2 OB_NTP_bind Helicase_C S1 DEAD AAA_22 PWI AAA_30 T2SSE AAA_14 AAA_19 SRP54 AAA ABC_tran AAA_7 Acyl-CoA_ox_N AAA_23
Motif
Other DBs
NCBI-GeneID: 856732
NCBI-ProteinID: NP_010929
SGD: S000000815
UniProt: P24384
Structure
PDB: 

Position
V:178841..182278
Genome map
AA seq 1145 aa AA seqDB search
MSDISKLIGAIVGSDDPVIIEFVLNIINKSGNLQEFIRNIQKLDAGISYEDSIKMYNAFL
GKQEEEKVRNKVKSSPLSQKINQVLKDDVNLDDPVVTEFVLSILNKSKSITEFQEQLNLM
QSGLDNETIFKIYQIASPPVMKEEVSVLPSTKIPAKIEAKIEEEVQKIESLDPSPVLHKV
YEGKVRNITTFGCFVQIFGTRMKNCDGLVHISEMSDQRTLDPHDVVRQGQHIFVEVIKIQ
NNGKISLSMKNIDQHSGEIRKRNTESVEDRGRSNDAHTSRNMKNKIKRRALTSPERWEIR
QLIASGAASIDDYPELKDEIPINTSYLTAKRDDGSIVNGNTEKVDSKLEEQQRDETDEID
VELNTDDGPKFLKDQQVKGAKKYEMPKITKVPRGFMNRSAINGSNAIRDHREEKLRKKRE
IEQQIRKQQSFDDPTKNKKDSRNEIQMLKNQLIVTEWEKNRMNESISYGKRTSLPISAQR
QTLPVYAMRSELIQAVRDNQFLVIVGETGSGKTTQITQYLDEEGFSNYGMIGCTQPRRVA
AVSVAKRVAEEVGCKVGHDVGYTIRFEDVTGPDTRIKYMTDGMLQREALLDPEMSKYSVI
MLDEAHERTVATDVLFALLKKAAIKRPELKVIVTSATLNSAKFSEYFLNCPIINIPGKTF
PVEVLYSQTPQMDYIEAALDCVIDIHINEGPGDILVFLTGQEEIDSCCEILYDRVKTLGD
SIGELLILPVYSALPSEIQSKIFEPTPKGSRKVVFATNIAETSITIDGIYYVVDPGFAKI
NIYNARAGIEQLIVSPISQAQANQRKGRAGRTGPGKCYRLYTESAFYNEMLENTVPEIQR
QNLSHTILMLKAMGINDLLKFDFMDPPPKNLMLNALTELYHLQSLDDEGKLTNLGKEMSL
FPMDPTLSRSLLSSVDNQCSDEIVTIISMLSVQNVFYRPKDRQLEADSKKAKFHHPYGDH
LTLLNVYTRWQQANYSEQYCKTNFLHFRHLKRARDVKSQISMIFKKIGLKLISCHSDPDL
IRKTFVSGFFMNAAKRDSQVGYKTINGGTEVGIHPSSSLYGKEYEYVMYHSIVLTSREYM
SQVTSIEPQWLLEVAPHFYKAGDAESQSRKKAKIIPLHNKFAKDQNSWRLSSIRQSRERA
LGIKR
NT seq 3438 nt NT seq  +upstreamnt  +downstreamnt
atgtctgatatatcgaaactcataggagctattgtgggatctgatgaccccgttatcatt
gaatttgtgctgaatatcataaataaatccggcaatttacaagagtttatacgaaatatt
caaaaattggatgccggtatatcctacgaagacagtattaagatgtataatgcattttta
ggaaagcaggaagaagaaaaggtacgaaataaagttaaaagttcaccgttaagtcaaaaa
attaatcaggtactgaaagatgacgttaatttggacgaccctgttgtgactgaattcgtc
ctgagcattttgaataaatctaaatcaataactgagttccaggaacaactgaacttgatg
caaagcggactcgataatgaaacaattttcaagatatatcaaattgcatcaccaccagta
atgaaagaagaagtctcagttcttccaagcaccaagataccagcaaagatagaagcaaag
attgaagaagaggtacaaaaaatagaaagtttagaccccagccctgtccttcacaaagtt
tatgaaggtaaagtgagaaacataactacttttgggtgtttcgtccaaatttttgggacg
cgaatgaagaattgtgatggcttagttcatatttcagaaatgtcagaccaaagaacatta
gatccacatgatgtggtgagacaaggccaacatatctttgtcgaagtgataaaaatacaa
aataatggaaaaatatcgctctccatgaaaaatattgatcaacatagtggagaaatccgg
aaaagaaatactgaaagtgtcgaagatagaggtaggtccaacgatgctcatacaagcaga
aatatgaaaaacaaaattaaaaggcgtgctttgacttcaccagaaagatgggaaattcgc
caactaattgccagcggtgctgcttccatcgatgactatcctgaattgaaggatgaaata
cccataaatacttcctatttgaccgcgaaaagagatgacggcagtatcgttaacggtaat
acagagaaagtggactcaaaattggaagaacaacaacgagacgagacggatgaaattgat
gtcgagctgaatacagatgatgggcccaaatttttaaaggatcagcaagtcaagggggcc
aagaaatatgaaatgcctaaaattacaaaagtcccgagaggatttatgaatcgttcagca
atcaacggctctaatgcaatacgagatcatagagaagaaaagttaaggaaaaaaagagag
attgaacaacagattaggaaacaacagtcgtttgatgatcctacgaaaaacaaaaaagat
tccaggaacgaaattcaaatgttgaaaaaccagctgattgttactgaatgggaaaaaaat
agaatgaatgaatctatctcgtatggcaaaagaacttccttaccaatcagtgcacagcgt
caaactttgcctgtatacgcgatgaggtctgaattgatacaggctgtgcgtgacaatcaa
tttctggtcattgttggtgagacaggttcgggtaaaaccactcaaattactcagtattta
gatgaagaagggtttagtaactatgggatgatcggatgtacccaacctcgtagggttgcc
gctgtatccgttgctaaaagagtggctgaagaagttggctgcaaagttggccatgacgtt
ggctataccattagatttgaagatgttactggcccagataccagaataaaatatatgact
gatggtatgttacagagagaggcgttgttagatcccgagatgtcaaaatattcagttatc
atgttagatgaagctcacgaaagaactgtggcaactgatgttttatttgcgttgttaaag
aaagcggctattaaaaggccagaattaaaagtaatagttacatcggctactttgaactct
gctaaattttctgagtactttttaaattgtccgattatcaatatacctggtaaaactttt
cccgtggaagtactctactcacagacgccccaaatggattacatagaggcagctttggat
tgtgtaatagacatccatattaatgaaggcccaggcgatattttagtctttttgactgga
caggaagaaatagactcatgctgtgaaattttatatgatagggtgaaaactttaggtgac
agcatcggcgaattactgattttgcccgtttattctgctttgccaagtgaaatccaatcg
aaaatttttgaacccactccaaagggcagtcgaaaagtcgtatttgccacaaatattgcg
gaaacttcaatcactattgatggaatttattatgtcgtggaccctggatttgcaaaaatc
aacatttataatgcaagagcaggtatcgagcagttgatagtgtctccaatctctcaggca
caggcaaatcaaagaaaaggtagagctggaagaacaggccctggaaaatgctatcgactt
tatacagaatccgcattttacaatgaaatgttagaaaacacggttccagaaattcaaagg
cagaatctttctcatactattttgatgctaaaggccatgggaattaatgatttattgaaa
tttgacttcatggatccccctcccaaaaatttaatgcttaacgcactgacagaattatac
cacctgcagtcactagatgacgagggaaaactaacaaatttaggtaaagagatgtcctta
tttccaatggatcccactctatcacgctctttattgtcatctgttgataatcagtgctcg
gatgaaattgttactataatctcaatgttgtcagtacagaacgttttttatcgtccaaaa
gataggcaattggaagcagatagcaagaaggcaaagtttcatcatccatacggtgaccat
ttaacattattgaacgtttatactagatggcagcaggcaaattactcggagcagtattgc
aaaacaaactttctgcattttagacatttgaaaagagcaagagatgttaaaagccaaatt
agcatgatatttaaaaagataggcttaaagttaataagctgtcatagtgatcctgattta
attcgtaaaactttcgtgtcagggttcttcatgaacgctgctaagcgagactcacaggta
ggttataaaaccatcaatggtggtacagaggttggaatacatccctcgagttcattgtac
ggaaaagagtatgaatacgtaatgtatcatagtatcgtattaactagccgggaatacatg
tcgcaggtaacatccattgagccccaatggcttctcgaagtagcgcctcatttttataaa
gctggagatgctgaaagccagtctaggaagaaagcgaaaatcattcctttgcataacaag
tttgccaaggatcaaaattcatggagactaagctcaataaggcagtcaagggaaagggca
ttaggtatcaagaggtaa

DBGET integrated database retrieval system