KEGG   Saccharomyces cerevisiae (budding yeast): YER031CHelp
Entry
YER031C           CDS       T00005                                 

Gene name
YPT31, YPT8
Definition
(RefSeq) Rab family GTPase YPT31
  KO
K07905  Ras-related protein Rab-11B
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:sce00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    YER031C (YPT31)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:sce04131]
    YER031C (YPT31)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sce04147]
    YER031C (YPT31)
   04031 GTP-binding proteins [BR:sce04031]
    YER031C (YPT31)
Membrane trafficking [BR:sce04131]
 Protein recycling
  Rab GTPases and associated proteins
   Rab GTPases
    YER031C (YPT31)
Exosome [BR:sce04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   YER031C (YPT31)
  Exosomal proteins of other body fluids (saliva and urine)
   YER031C (YPT31)
  Exosomal proteins of colorectal cancer cells
   YER031C (YPT31)
GTP-binding proteins [BR:sce04031]
 Small (Monomeric) G-proteins
  Rab Family
   Rab11/25 [OT]
    YER031C (YPT31)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ras Roc Arf MMR_HSR1 Gtr1_RagA GTP_EFTU KAP_NTPase RsgA_GTPase AAA_22 PduV-EutP AAA_24 SRPRB AAA_16 ABC_tran Septin FeoB_N GCP_N_terminal TniB AAA_7 MCM AAA_18 AAA_21
Motif
Other DBs
NCBI-GeneID: 856753
NCBI-ProteinID: NP_010948
SGD: S000000833
UniProt: P38555
Structure
PDB: 

Position
V:complement(214076..214747)
Genome map
AA seq 223 aa AA seqDB search
MSSEDYGYDYDLLFKIVLIGDSGVGKSNLLSRFTKNEFNMDSKSTIGVEFATRTLEIDGK
RIKAQIWDTAGQERYRAITSAYYRGAVGALIVYDISKSSSYENCNHWLSELRENADDNVA
VGLIGNKSDLAHLRAVPTEESKTFAQENQLLFTETSALNSENVDKAFEELINTIYQKVSK
HQMDLGDSSANGNANGASAPNGPTISLTPTPNENKKANGNNCC
NT seq 672 nt NT seq  +upstreamnt  +downstreamnt
atgagcagcgaggactacgggtatgattacgacctactatttaaaattgtactgatcggt
gattccggggtagggaaatccaatctattgtcaagatttacgaagaacgaattcaatatg
gattcaaagtctacaattggggttgagtttgccaccagaactttggaaattgatggcaag
aggatcaaggcgcagatttgggatactgcgggccaggaacgttacagagccattacttct
gcttattatagaggagctgtaggtgccttgatcgtttacgatatcagtaaatcaagctca
tatgaaaattgtaatcattggttatcagaattaagagaaaatgcagatgacaacgtcgca
gtggggcttatcggtaacaagtctgatttggcccatttacgtgctgtacctacggaggag
tccaagacttttgcacaggaaaatcagttattattcacagaaacaagtgctttgaacagt
gaaaacgtggataaggcttttgaagagttaatcaataccatctatcaaaaggtcagcaag
catcaaatggaccttggtgactccagtgccaacgggaatgccaatggtgcgtccgctcct
aatggaccaacgattagtctgacaccaacaccaaacgaaaacaaaaaggcaaatggaaat
aactgttgttaa

DBGET integrated database retrieval system