KEGG   Saccharomyces cerevisiae (budding yeast): YER034WHelp
Entry
YER034W           CDS       T00005                                 

Definition
(RefSeq) hypothetical protein
Organism
sce  Saccharomyces cerevisiae (budding yeast)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF5364 S_100
Motif
Other DBs
NCBI-GeneID: 856756
NCBI-ProteinID: NP_010951
SGD: S000000836
UniProt: P40022
Position
V:221846..222403
Genome map
AA seq 185 aa AA seqDB search
MDAFSLKKDNRKKFQDKQKLKRKHATPSDRKYRLLNRQKEEKATTEEKDQDQEQPALKSN
EDRYYEDPVLEDPHSAVANAELNKVLKDVLKNRLQQNDDATAVNNVANKDTLKIKDLKQM
NTDELNRWLGRQNTTSAITAAEPESLVVPIHVQGDHDRAGKKISAPSTDLPEELETDQDF
LDGLL
NT seq 558 nt NT seq  +upstreamnt  +downstreamnt
atggatgcattcagcttaaagaaggataatcgaaaaaaatttcaagataaacagaaattg
aaaagaaaacatgccacacccagtgatagaaagtaccggctattgaaccgccaaaaagaa
gagaaagctaccacagaggagaaagatcaagaccaagaacagcccgccctgaagtcaaac
gaggacaggtactatgaggacccggtactcgaggacccgcattctgcagtcgccaatgca
gagttgaacaaggtgctaaaagacgtcctcaaaaatcggctccagcagaacgacgacgcc
acagccgtcaataatgttgctaataaagatactttgaaaatcaaagacctcaagcagatg
aatacggatgagctcaatcgttggctcggacggcagaatacaacatcggctataacagcg
gctgagcccgaatcattagtcgttcccattcacgtacaaggtgatcatgatcgtgcgggc
aagaagatcagtgccccttcgaccgatctaccggaagaactagagaccgatcaggatttc
cttgatggactgctctaa

DBGET integrated database retrieval system