KEGG   Saccharomyces cerevisiae (budding yeast): YER036CHelp
Entry
YER036C           CDS       T00005                                 

Gene name
ARB1
Definition
(RefSeq) ATP-binding cassette family ATPase ARB1
  KO
K06185  ATP-binding cassette, subfamily F, member 2
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Brite
KEGG Orthology (KO) [BR:sce00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:sce03009]
    YER036C (ARB1)
Ribosome biogenesis [BR:sce03009]
 Eukaryotic Type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    YER036C (ARB1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran ABC_tran_Xtn AAA_21 SMC_N RsgA_GTPase AAA_29 AAA_23 AAA_22 AAA_18 MMR_HSR1 AAA_15 AAA_16 RNA_helicase AAA AAA_33 AAA_28 NACHT AAA_24 Rad17 MCM NB-ARC T2SSE IstB_IS21
Motif
Other DBs
NCBI-GeneID: 856758
NCBI-ProteinID: NP_010953
SGD: S000000838
UniProt: P40024
Position
V:complement(223367..225199)
Genome map
AA seq 610 aa AA seqDB search
MPPVSASKAKRDAKKAEREAKKAAAGKTIRKLGRKKEAAAEESEVDAAAREIKMMKLQQD
KDGLSDRVVTGVLSSLETSRDIKLSSVSLLFHGKVLIQDSGLELNYGRRYGLLGENGCGK
STFLKALATREYPIPEHIDIYLLDEPAEPSELSALDYVVTEAQHELKRIEDLVEKTILED
GPESELLEPLYERMDSLDPDTFESRAAIILIGLGFNKKTILKKTKDMSGGWKMRVALAKA
LFVKPTLLLLDDPTAHLDLEACVWLEEYLKRFDRTLVLVSHSQDFLNGVCTNMIDMRAQK
LTAYGGNYDSYHKTRSELETNQMKQYNKQQEEIQHIKKFIASAGTYANLVKQAKSRQKIL
DKMEADGLVQPVVPDKVFSFRFPQVERLPPPVLAFDDISFHYESNPSENLYEHLNFGVDM
DSRIALVGPNGVGKSTLLKIMTGELTPQSGRVSRHTHVKLGVYSQHSQDQLDLTKSALEF
VRDKYSNISQDFQFWRGQLGRYGLTGEGQTVQMATLSEGQRSRVVFALLALEQPNVLLLD
EPTNGLDIPTIDSLADAINEFNGGVVVVSHDFRLLDKIAQDIFVVENKTATRWDGSILQY
KNKLAKNVVL
NT seq 1833 nt NT seq  +upstreamnt  +downstreamnt
atgccaccagtatctgcgtcaaaggccaagagagatgctaagaaagctgaaagagaggct
aagaaagccgctgccggtaaaaccatcagaaagctaggtagaaaaaaggaggctgctgct
gaagaatcggaggtagatgcagccgctagagaaatcaagatgatgaagttgcaacaagat
aaggatggtctttcagatcgtgttgtcactggtgttttgagttcattggagacttcccgt
gatatcaagctatcttctgtttctttactgttccacggtaaagttttgatccaagattct
ggtttagaattaaactacggccgtagatatggtcttctgggagaaaatggttgtggtaag
tcaacattcttaaaggctcttgctactagagaatatcctattcctgagcatattgatatt
tatttattggacgaacctgcggaaccaagtgaattgtcggccttggactacgttgtcact
gaagctcaacacgaattgaaaagaatagaagacttagtcgaaaagactatcttggaagat
ggtcctgagtccgagttattagagcctctatatgaaagaatggactctttggatccagac
acctttgaatctagagctgctatcattttgatcggtctaggtttcaacaagaagaccatt
ttgaagaaaaccaaagatatgtctggtggatggaaaatgcgtgttgcgttggcaaaagct
cttttcgttaagccaactctattattgttggatgatcctactgcgcatctggatttggaa
gcttgtgtttggttagaagaatatttgaagagatttgacagaactttagttttggtgtcc
cactctcaagatttcttgaacggtgtttgtaccaatatgattgacatgagagctcaaaaa
ctaactgcttacggtggtaactatgattcttatcacaagacaagatccgaattggaaacc
aatcaaatgaaacaatacaataaacaacaagaggaaatccaacatattaaaaaattcatt
gcatctgctggtacttatgctaacttggtgaaacaagctaaatctagacaaaaaattttg
gacaagatggaagcagatggtttagtccaacctgtcgtccctgacaaagttttctcattt
agattcccacaagtggaaagattgccaccaccagttttagcattcgatgatatttcattt
cattatgagagcaacccatccgaaaacttgtacgaacatttgaactttggtgtcgatatg
gactcacgtattgcccttgtcggaccaaatggtgttggtaaatccacattgttgaagatt
atgaccggtgaattgaccccacaatctggccgtgtttctagacatacccatgtcaagttg
ggtgtctactcgcaacactctcaagatcaactggacttgacaaaatctgctttagaattt
gtccgtgacaagtactctaacatctcacaagatttccaattctggagaggccaactaggt
cgctacgggctaaccggggaaggtcaaaccgttcaaatggctaccttgtcagaaggtcaa
cgttctcgtgtcgtctttgctttattagctttagaacaaccaaatgtcctactattagat
gaacctaccaatggtttggatatcccaaccatcgactccttggccgacgccatcaacgaa
tttaacggtggtgtcgtcgtcgtttcgcatgatttcagattattagacaaaattgcccaa
gatattttcgttgtggaaaacaagaccgctaccagatgggacggatccattttgcaatat
aagaacaaattggccaagaacgttgttttgtaa

DBGET integrated database retrieval system