KEGG   Saccharomyces cerevisiae (budding yeast): YER040WHelp
Entry
YER040W           CDS       T00005                                 

Gene name
GLN3
Definition
(RefSeq) nitrogen-responsive transcriptional regulator GLN3
  KO
K09184  GATA-binding protein, other eukaryote
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Brite
KEGG Orthology (KO) [BR:sce00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:sce03000]
    YER040W (GLN3)
Transcription factors [BR:sce03000]
 Eukaryotic Type
  Zinc finger
   Cys4 GATA-factors
    YER040W (GLN3)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GATA TF_Zn_Ribbon
Motif
Other DBs
NCBI-GeneID: 856763
NCBI-ProteinID: NP_010958
SGD: S000000842
UniProt: P18494
Position
V:229795..231987
Genome map
AA seq 730 aa AA seqDB search
MQDDPENSKLYDLLNSHLDVHGRSNEEPRQTGDSRSQSSGNTGENEEDIAFASGLNGGTF
DSMLEALPDDLYFTDFVSPFTAAATTSVTTKTVKDTTPATNHMDDDIAMFDSLATTQPID
IAASNQQNGEIAQLWDFNVDQFNMTPSNSSGSATISAPNSFTSDIPQYNHGSLGNSVSKS
SLFPYNSSTSNSNINQPSINNNSNTNAQSHHSFNIYKLQNNNSSSSAMNITNNNNSNNSN
IQHPFLKKSDSIGLSSSNTTNSVRKNSLIKPMSSTSLANFKRAASVSSSISNMEPSGQNK
KPLIQCFNCKTFKTPLWRRSPEGNTLCNACGLFQKLHGTMRPLSLKSDVIKKRISKKRAK
QTDPNIAQNTPSAPATASTSVTTTNAKPIRSRKKSLQQNSLSRVIPEEIIRDNIGNTNNI
LNVNRGGYNFNSVPSPVLMNSQSYNSSNANFNGASNANLNSNNLMRHNSNTVTPNFRRSS
RRSSTSSNTSSSSKSSSRSVVPILPKPSPNSANSQQFNMNMNLMNTTNNVSAGNSVASSP
RIISSANFNSNSPLQQNLLSNSFQRQGMNIPRRKMSRNASYSSSFMAASLQQLHEQQQVD
VNSNTNTNSNRQNWNSSNSVSTNSRSSNFVSQKPNFDIFNTPVDSPSVSRPSSRKSHTSL
LSQQLQNSESNSFISNHKFNNRLSSDSTSPIKYEADVSAGGKISEDNSTKGSSKESSAIA
DELDWLKFGI
NT seq 2193 nt NT seq  +upstreamnt  +downstreamnt
atgcaagacgaccccgaaaattcgaagctgtacgacctgctgaatagtcatctggacgtg
catggtcgaagtaatgaagagccgagacaaactggtgacagtaggagccagagtagtggc
aacaccggtgaaaacgaggaggatatagcatttgccagtggattaaacggcggcacattc
gactcaatgctggaggcactgcccgatgatttatattttacggacttcgtgtctcctttt
acagcagctgccacgaccagcgtgactactaagacggtcaaggacaccacaccagctacc
aatcatatggatgatgatattgcgatgtttgattcacttgccacaactcagcccatcgac
atagccgcatccaaccaacaaaatggtgaaattgcacaactttgggactttaacgtggac
caattcaacatgacgcccagcaactcgagcggttcagctactattagtgctcctaacagc
tttacttccgacataccgcaatacaaccacggttccctcggcaacagcgtctccaaatcc
tcactgttcccgtataattccagcacgtccaacagcaacatcaaccagccatctatcaat
aacaactcaaatactaatgcgcagtcccaccattccttcaacatctacaaactacaaaac
aacaactcatcttcatccgctatgaacattaccaataataataatagcaacaatagtaat
atccagcatccttttctgaagaagagcgattcgataggattatcttcatccaacacaaca
aattctgtaagaaaaaactcacttatcaagccaatgtcgtccacgtccctggccaatttc
aaaagagctgcctcagtatcttccagtatatccaatatggaaccatcaggacaaaataaa
aaacctctgatacaatgtttcaattgtaaaactttcaagacaccgctttggaggagaagc
ccagaggggaatactctttgcaatgcctgcggtcttttccagaaattacatggtaccatg
aggccattatccttaaaatcggacgttatcaaaaagaggatttcaaagaagagagccaaa
caaacggacccaaacattgcacaaaatactccaagtgcacctgcaactgcctcaacttca
gtaaccactacaaatgctaaacccatacgatcgaggaaaaaatcactacaacaaaactct
ttatctagagtgatacctgaagaaatcattagagacaacatcggtaatactaataatatc
cttaatgtaaataggggaggctataacttcaactcagtcccctccccggtcctcatgaac
agccaatcgtataatagtagtaacgcaaattttaatggagcaagcaatgcaaatttgaat
tctaataacttaatgcgtcacaattcgaacactgttactcctaattttagaaggtcttca
agacgaagtagtacttcatcgaacacctcaagttccagtaaatcttcatccagatctgtt
gttccgatattaccaaaaccttcacctaatagcgctaattcacagcagttcaacatgaac
atgaacctaatgaacacaacaaataatgtaagtgcaggaaatagtgtcgcatcctcacca
agaattatatcgtccgcaaactttaactcaaatagtcctctacagcagaatctattatca
aattctttccaacgtcaaggaatgaatataccaagaagaaagatgtcgcgcaatgcatcg
tactcctcatcgtttatggctgcgtctttgcaacaactgcacgaacagcaacaagtggac
gtgaattccaacacaaacacgaattcgaatagacagaattggaattcaagcaatagcgtt
tcaacaaattcaagatcatcaaattttgtctctcaaaagccaaattttgatatttttaat
actcctgtagattcaccgagtgtctcaagaccttcttcaagaaaatcacatacctcattg
ttatcacaacaattgcagaactcggagtcgaattcgtttatctcaaatcacaaatttaac
aatagattatcaagtgactctacttcacctataaaatatgaagcagatgtgagtgcaggc
ggaaagatcagtgaggataattccacaaaaggatcttctaaagaaagttcagcaattgct
gacgaattggattggttaaaatttggtatatga

DBGET integrated database retrieval system