KEGG   Saccharomyces cerevisiae (budding yeast): YER042WHelp
Entry
YER042W           CDS       T00005                                 

Gene name
MXR1
Definition
(RefSeq) peptide-methionine-S-sulfoxide reductase
  KO
K07304  peptide-methionine (S)-S-oxide reductase [EC:1.8.4.11]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Brite
KEGG Orthology (KO) [BR:sce00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    YER042W (MXR1)
Enzymes [BR:sce01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.4  With a disulfide as acceptor
    1.8.4.11  peptide-methionine (S)-S-oxide reductase
     YER042W (MXR1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PMSR
Motif
Other DBs
NCBI-GeneID: 856765
NCBI-ProteinID: NP_010960
SGD: S000000844
UniProt: P40029
Structure
PDB: 

Position
V:234937..235491
Genome map
AA seq 184 aa AA seqDB search
MSSLISKTIKYDPAKDKLITLACGCFWGTEHMYRKYLNDRIVDCKVGYANGEESKKDSPS
SVSYKRVCGGDTDFAEVLQVSYNPKVITLRELTDFFFRIHDPTTSNSQGPDKGTQYRSGL
FAHSDADLKELAKIKEEWQPKWGNKIATVIEPIKNFYDAEEYHQLYLDKNPQGYACPTHY
LREM
NT seq 555 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtcgcttatttcaaaaaccattaagtatgatccagccaaggataaattaatcaca
ttagcatgtggatgtttttggggtacagaacatatgtataggaagtatttgaatgaccgt
atagtggattgtaaagtaggttacgctaatggagaagagtctaaaaaggatagcccctct
agtgtctcttataagagagtttgtggtggtgacacagattttgcggaggttttacaagta
tcctataatcccaaagtgataactttgagagaattaactgatttcttttttagaatccat
gatcctactacatctaattcacaaggacctgataaaggtacacagtatcgcagtggattg
ttcgctcattcagatgctgatttaaaagaattagccaaaataaaggaagaatggcaacca
aaatggggtaataagattgccacagttattgaaccaatcaagaacttttacgatgctgaa
gaataccaccagttatatttagataagaatccacagggatatgcatgccctactcattat
ctgagagaaatgtag

DBGET integrated database retrieval system