KEGG   Saccharomyces cerevisiae (budding yeast): YER043C
Entry
YER043C           CDS       T00005                                 

Gene name
SAH1
Definition
(RefSeq) adenosylhomocysteinase
  KO
K01251  adenosylhomocysteinase [EC:3.3.1.1]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce00270  Cysteine and methionine metabolism
sce01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sce00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    YER043C (SAH1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:sce01009]
    YER043C (SAH1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sce04147]
    YER043C (SAH1)
Enzymes [BR:sce01000]
 3. Hydrolases
  3.3  Acting on ether bonds
   3.3.1  Thioether and trialkylsulfonium hydrolases
    3.3.1.1  adenosylhomocysteinase
     YER043C (SAH1)
Protein phosphatases and associated proteins [BR:sce01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     YER043C (SAH1)
Exosome [BR:sce04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   YER043C (SAH1)
SSDB
Motif
Pfam: AdoHcyase AdoHcyase_NAD 2-Hacid_dh_C TrkA_N IlvN Urocanase PALP
Other DBs
NCBI-GeneID: 856766
NCBI-ProteinID: NP_010961
SGD: S000000845
UniProt: P39954
Position
V:complement(235770..237119)
AA seq 449 aa
MSAPAQNYKIADISLAAFGRKEIELAEHEMPGLMAIRKAYGDVQPLKGARIAGCLHMTIQ
TAVLIETLVALGAEVTWSSCNIYSTQDHAAAAIAASGVPVFAWKGETEEEYLWCIEQQLF
AFKDNKKLNLILDDGGDLTTLVHEKHPEMLEDCFGLSEETTTGVHHLYRMVKEGKLKVPA
INVNDSVTKSKFDNLYGCRESLVDGIKRATDVMLAGKVAVVAGYGDVGKGCAAALRGMGA
RVLVTEIDPINALQAAMEGYQVVTMEDASHIGQVFVTTTGCRDIINGEHFINMPEDAIVC
NIGHFDIEIDVAWLKANAKECINIKPQVDRYLLSSGRHVILLANGRLVNLGCATGHSSFV
MSCSFSNQVLAQIALFKSNDKSFREKHIEFQKTGPFEVGVHVLPKILDEAVAKFHLGNLG
VRLTKLSKVQSEYLGIPEEGPFKADHYRY
NT seq 1350 nt   +upstreamnt  +downstreamnt
atgtctgctccagctcaaaactacaaaatcgctgatatctctttggctgccttcggtaga
aaggaaatcgaattggctgaacatgaaatgccaggtttgatggccatcagaaaggcttac
ggtgacgtccaacctttgaaaggcgcccgtattgctggttgtttgcacatgaccattcaa
actgctgttttaattgaaactttagttgctttgggtgccgaagttacctggtcctcttgt
aacatctattcgactcaagatcatgccgccgctgctattgccgcttccggtgttccagtt
tttgcctggaagggtgaaactgaagaagagtatttgtggtgtattgaacaacaattgttt
gccttcaaggacaacaagaaattgaacttgatcttagatgatggtggtgatttaaccact
ttagttcatgaaaagcaccctgaaatgctggaagactgctttggtctttccgaagaaact
accaccggtgttcaccacttatacagaatggtcaaagaaggcaagttaaaggttcctgcc
attaacgttaacgactccgtcactaagtccaagtttgacaacttgtacggctgtagagaa
tccttagtcgacggtattaagagagccactgatgtcatgttggctggtaaggttgccgtt
gttgctggttacggtgatgtcggtaagggttgtgctgctgccttaagaggaatgggtgct
cgtgtcttggttaccgaaattgacccaatcaacgctttacaagctgccatggaaggctac
caagttgttaccatggaagatgcatcccacattggtcaagttttcgttaccaccactggt
tgtagagatattatcaacggtgaacatttcatcaacatgccagaagatgccattgtttgt
aacattggccatttcgatatcgaaattgatgtcgcctggttaaaggctaacgctaaagaa
tgtattaacatcaaaccacaagtcgaccgttacttgttgtcttctggtagacacgtcatc
ttgttggctaacggtagattagttaacttgggttgtgctactggtcactcatctttcgtt
atgtcttgttccttctctaaccaagtcttagctcaaattgctttgttcaagtctaacgat
aagtctttcagagaaaagcacattgaattccaaaagacaggcccattcgaagttggtgtc
cacgttttgccaaagatcttggatgaagctgtcgctaagttccacttgggcaacttgggt
gttagattgactaaattgagtaaagtccaatctgaatacttgggtattccagaagaaggt
ccattcaaggccgaccactacagatattga

DBGET integrated database retrieval system