KEGG   Saccharomyces cerevisiae (budding yeast): YER044CHelp
Entry
YER044C           CDS       T00005                                 

Gene name
ERG28, BUD18
Definition
(RefSeq) Erg28p
Organism
sce  Saccharomyces cerevisiae (budding yeast)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Erg28 MtN3_slv
Motif
Other DBs
NCBI-GeneID: 856767
NCBI-ProteinID: NP_010962
SGD: S000000846
UniProt: P40030
Position
V:complement(237570..238016)
Genome map
AA seq 148 aa AA seqDB search
MFSLQDVITTTKTTLAAMPKGYLPKWLLFISIVSVFNSIQTYVSGLELTRKVYERKPTET
THLSARTFGTWTFISCVIRFYGAMYLNEPHIFELVFMSYMVALFHFGSELLIFRTCKLGK
GFMGPLVVSTTSLVWMYKQREYYTGVAW
NT seq 447 nt NT seq  +upstreamnt  +downstreamnt
atgttcagcctacaagacgtaataactacaaccaagaccaccttggcagcaatgccaaaa
ggttacttaccaaaatggttacttttcatttccattgtatcagtcttcaattctatccag
acttacgtttctggtttagaattgacacgtaaagtctacgaaagaaaacccactgaaaca
acccatttgagtgcaagaactttcggtacttggacctttatttcctgtgttatcagattc
tatggggctatgtacttgaatgaaccacacattttcgaattggtcttcatgtcttatatg
gttgccctattccacttcggctctgaattattgatctttagaacttgtaagttgggaaag
ggattcatgggtccattggttgtctcaaccacctctttggtttggatgtacaaacaaaga
gaatactacactggtgttgcttggtaa

DBGET integrated database retrieval system