KEGG   Saccharomyces cerevisiae (budding yeast): YER049WHelp
Entry
YER049W           CDS       T00005                                 

Gene name
TPA1
Definition
(RefSeq) oxidative DNA demethylase
Organism
sce  Saccharomyces cerevisiae (budding yeast)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ofd1_CTDD 2OG-FeII_Oxy_4 2OG-FeII_Oxy_3 2OG-FeII_Oxy
Motif
Other DBs
NCBI-GeneID: 856775
NCBI-ProteinID: NP_010969
SGD: S000000851
UniProt: P40032
Structure
PDB: 

Position
V:251728..253662
Genome map
AA seq 644 aa AA seqDB search
MKRKTAEVKGEKERNSKQISLEEDKIKGMFNPKIWDKTFQDGLKKEIEDSQPYNWGTIHE
LVNDDLLRAVRKEIETEIHFTKKETDIYRVNQSGDLANLSGLDWDDLSRLPNLFKLRQIL
YSKQYRDFFGYVTKAGKLSGSKTDMSINTYTKGCHLLTHDDVIGSRRISFILYLPDPDRK
WKSHYGGGLRLFPSILPNVPHSDPSAKLVPQFNQIAFFKVLPGFSFHDVEEVKVDKHRLS
IQGWYHIPQVGEEGYIPGEEEAWVRNNTSTLAQIESNVLEDFEFPKDERNILSFHEVKHF
EKMLKGDAGAKTDNTPKESMTSVISDSVKLSEAEFTYLSQYISPEHLSSKGIEKLQKQFV
ENSSLQIESFLNDDKSELLKKVIKQKELEQECPYHSKDVKAPWKTAIPPHKARYLYIDGK
EYRNFQTEADILEALNNNDLPNFQFTKDAIKIISDASGNSRENNFDAELALIDLAVFHKS
TIFKKYLALLTSLCPVSEQILIRRFRPGMDFTLATKCRFNELLKSNPDIIDAVLEGTLCL
TPSAGWESGELGGYELYMMDDDEDNKQYLKEDVEDASVYRADDSGDSVLINDPPAWNTFN
LVLRDESVLEFVKYVSWSAKSSRWDVKMKWDVKSCDEDGQEDEA
NT seq 1935 nt NT seq  +upstreamnt  +downstreamnt
atgaagagaaaaactgctgaagttaaaggtgagaaggagagaaattccaaacaaatttcc
ctcgaagaggacaagataaagggtatgttcaaccctaaaatctgggacaagactttccag
gatggcttgaaaaaggaaattgaagactctcagccttacaactggggtactattcatgaa
ttggttaatgacgatcttctacgtgctgttcgtaaagaaatagaaactgagatccatttc
actaaaaaagaaaccgatatctatagagtcaaccaaagtggtgacttggccaatttgtct
ggtctggactgggatgacttgtcccgtttgcctaatttgttcaagctgcgccagattctg
tattccaagcaatatcgagatttttttggctacgtcaccaaagctggtaaattgtctggt
tctaagaccgacatgagcatcaacacttacacaaagggatgtcacttgttgactcatgat
gacgttattggctctagaaggattagtttcattttatacctaccagatcccgacagaaaa
tggaaatcgcattatggtggtggtctaagactttttccaagtattttaccaaacgttcca
cattccgatccatctgctaaactagttccacagttcaatcaaattgcttttttcaaagtt
ttaccgggtttctctttccacgatgtcgaagaagtcaaagttgataagcacagattatct
attcaaggatggtaccatattccacaagttggcgaagaaggttacatacctggtgaagaa
gaagcgtgggtccgtaacaacacatccactttggcgcagattgaatctaatgtcctagaa
gattttgaatttccaaaggacgagagaaatattttatcatttcatgaagtgaagcacttt
gaaaaaatgctcaagggcgatgctggcgcaaaaactgataacacacctaaagaatctatg
actagtgtgatttctgattcggttaagttgtctgaagccgagttcacctatctatctcaa
tacatctctcctgaacatttaagctcgaaaggtatcgaaaaactacaaaagcagtttgtt
gagaactcttctctacaaattgagtcgtttttaaatgacgataaatcagaattgttaaag
aaggttatcaaacaaaaagagttggaacaggaatgtccttatcattcaaaagatgtgaaa
gctccgtggaaaacggctattcctccacacaaagcccgttatttgtacatcgacggtaag
gaataccgtaatttccaaacagaagctgatattcttgaggcgctgaataacaatgatttg
ccaaactttcagtttactaaggacgcaattaaaattatctccgatgcttccggaaatagt
agggaaaacaattttgatgcagaattagcgttgattgacctagctgtatttcacaagagc
acaattttcaagaaatacctagctcttctaacttctttgtgcccagtcagtgagcaaatc
cttattagaaggtttaggccaggaatggatttcacattggccaccaaatgtcgctttaat
gaacttttgaaaagcaatccagatataatcgatgctgtcttggaaggtactttgtgcttg
acaccttctgccggttgggaatccggagagcttggtggttacgaattgtacatgatggac
gacgacgaagataataagcaatacttaaaggaagacgttgaagacgcttctgtttatcgt
gcggatgacagtggtgattcagtattgattaatgatccacctgcttggaatactttcaat
ttggtcttgagagatgaaagtgttttggagtttgttaagtacgtcagctggagcgctaaa
tctagtagatgggatgtcaaaatgaagtgggatgtcaaatcatgtgatgaagatggtcag
gaagatgaagcgtaa

DBGET integrated database retrieval system