KEGG   Saccharomyces cerevisiae (budding yeast): YER053C
Entry
YER053C           CDS       T00005                                 

Gene name
PIC2
Definition
(RefSeq) Cu/Pi carrier
  KO
K15102  solute carrier family 25 (mitochondrial phosphate transporter), member 3
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Brite
KEGG Orthology (KO) [BR:sce00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:sce02000]
    YER053C (PIC2)
   04147 Exosome [BR:sce04147]
    YER053C (PIC2)
Transporters [BR:sce02000]
 Solute carrier family (SLC)
  SLC25: Mitochondrial carrier
   YER053C (PIC2)
Exosome [BR:sce04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   YER053C (PIC2)
SSDB
Motif
Pfam: Mito_carr
Other DBs
NCBI-GeneID: 856779
NCBI-ProteinID: NP_010973
SGD: S000000855
UniProt: P40035
Position
V:complement(258737..259639)
AA seq 300 aa
MESNKQPRKIQLYTKEFYATCTLGGIIACGPTHSSITPLDLVKCRLQVNPKLYTSNLQGF
RKIIANEGWKKVYTGFGATFVGYSLQGAGKYGGYEYFKHLYSSWLSPGVTVYLMASATAE
FLADIMLCPFEAIKVKQQTTMPPFCNNVVDGWKKMYAESGGMKAFYKGIVPLWCRQIPYT
MCKFTSFEKIVQKIYSVLPKKKEEMNALQQISVSFVGGYLAGILCAAVSHPADVMVSKIN
SERKANESMSVASKRIYQKIGFTGLWNGLMVRIVMIGTLTSFQWLIYDSFKAYVGLPTTG
NT seq 903 nt   +upstreamnt  +downstreamnt
atggagtccaataaacaaccacgtaaaatccaattatatacgaaagagttttatgccaca
tgtaccttaggtggtataattgcgtgcggtccaacacattcttcgatcactccactagat
cttgtcaaatgtaggctacaggtcaatcccaagttgtatacttcaaacttacaagggttc
cgtaagattatagctaatgaaggctggaagaaagtatacactgggtttggtgctacattc
gtcggatattcgctacaaggtgcaggtaagtatggtggttatgagtatttcaagcatttg
tattctagttggttaagtcctggtgtcactgtgtacttgatggcctcagcgaccgctgaa
ttcctcgctgatatcatgttgtgcccatttgaagctattaaagtgaaacagcagactact
atgccgcccttttgcaataacgttgttgatggatggaaaaaaatgtatgcagaaagtgga
ggtatgaaagcattttataaaggtattgttcccctatggtgcagacagattccttacaca
atgtgtaagtttacctcattcgaaaaaattgttcaaaaaatatacagtgttttacctaaa
aagaaagaagaaatgaacgcattacagcaaatatcagtcagttttgtaggtggttatctg
gcaggtatattatgtgctgcagtctcacatcctgcagacgttatggtttccaagatcaat
agcgaaagaaaggccaacgagtccatgtctgtagcctctaaaagaatatatcaaaaaatt
ggctttactgggttgtggaatgggttaatggtgagaattgtcatgatcggtactttgaca
agtttccaatggctaatttacgattcgttcaaggcttatgtaggcttaccaaccaccggt
tag

DBGET integrated database retrieval system