KEGG   Saccharomyces cerevisiae (budding yeast): YER093CHelp
Entry
YER093C           CDS       T00005                                 

Gene name
TSC11, AVO3
Definition
(RefSeq) TORC2 complex subunit TSC11
  KO
K08267  rapamycin-insensitive companion of mTOR
Organism
sce  Saccharomyces cerevisiae (budding yeast)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RICTOR_N RICTOR_M RICTOR_V RasGEF_N_2 K_oxygenase
Motif
Other DBs
NCBI-GeneID: 856828
NCBI-ProteinID: NP_011018
SGD: S000000895
UniProt: P40061
Position
V:complement(343320..347612)
Genome map
AA seq 1430 aa AA seqDB search
MSIPHSAKQSSPLSSRRRSVTNTTPLLTPRHSRDNSSTQISSAKNITSSSPSTITNESSK
RNKQNLVLSTSFISTKRLENSAPSPTSPLMARRTRSTMTKALLNLKAEINNQYQELARLR
KKKDDIEHLRDSTISDIYSGSYSTNHLQKHSMRIRANTQLREIDNSIKRVEKHIFDLKQQ
FDKKRQRSLTTSSSIKADVGSIRNDDGQNNDSEELGDHDSLTDQVTLDDEYLTTPTSGTE
RNSQQNLNRNSTVNSRNNENHSTLSIPDLDGSNKVNLTGDTEKDLGDLENENQIFTSTTT
EAATWLVSDYMQSFQEKNVNPDFIAQKANGLVTLLKEHSEIRKDLVLTSFMSSIQNLLLN
GNKLIAASAYRVCRYLINSSIFIDELLELRLDAFIIISLAKDNSFQIEREQALKMVRRFI
EYNNGVTQGIMQAIISCVEKPEDSLRHMALETLLELCFVAPEMVKECRGMRVIEGFLQDY
TSFSLASVILDTILQLMATHKTRQHFLEDFNVSVLTTVFSDTNTKSNVNVEKMQNASTLI
SITLNSYNGFMLFSNNNFKPLKQLVSFFQIPICAQYLIDIFLDVLKIKPLPYKPRGRHSH
SFKPIPSQYYKECMSVNQRLALIVLILENSEFVPHLLELLNEEDRDDHLVAKGRYLLTEY
FNLRMNLVDKKYTSVSKPIYKENFTYVNETFQFKKIAYKMNRNRNTIGMSGIDYAQNIKS
FSKNIKENTLLREVDDFRFRRMVYDSKVLQTKDFTRWNWNIINELLEGPLLNKKQLEELV
KSTKFIRRLLVFYRPLRLRFSNVNKGAKLSQKYVQVGCQFFKTLTATPEGMKILMDDTKI
IPQLASLMFRAMEGNISGNIFNKNKLREKIIFGYFKFIGILTQSKNGVHILTRWNFFTVI
YKMFQFESKLGLEFLLLTIPELDLKYSSHCRVIIGKALVVANEKVRIEATKHIGDKLKEL
LSTKESDLKLKANKVKLQQFKMEMLTRQLYDLSPSVVAVADQALYECIVAGNGSEELGTS
FRMFLNQMVFIRSPILFELLSRPYGFQLLNEINFVKEERDSWLSKKNIEYVHIVEEFLKK
NESINAKSLTFQQKSRLPLHFYESLTKTEDGILLLSQTGDLVTFMNVIKKYVNGNNMATV
ENAKEILDLKAALWCVGFIGSTELGIGLLDNYSLVEDIIEVAYNASVTSVRFTAFYVLGL
ISMTREGCEILDEMGWNCCVSVQDEPIGIALPNRLDRFLSYNEHKWSAFGEYSDEMIVFN
KSDGDLIEKCLPIEFDLDKLLKEKDTAENPLNEKIITNKYDNDITSQTITVSGENSSLFA
NEGLSSPYVTQYRNDDDSIESKVLHIVSQLGNHILSNHAVKEITEINNKYGPRLFENEKM
FFKVFNMMSKYRFKPHVRKFLCGLFINNRALENVIRHDNKRDKRPANFTR
NT seq 4293 nt NT seq  +upstreamnt  +downstreamnt
atgagcatacctcacagtgcaaaacagagtagccctctctcaagtcggcgccggtcagta
actaatactactccactgttaacccctagacatagccgtgataactcgagcacccaaata
tcaagcgccaagaacatcacctccagcagcccatcaaccataacgaatgaaagttccaaa
agaaataaacaaaatctggtactctcgacctcatttatctccaccaagaggctagaaaat
agtgcaccttcaccgaccagtcccttaatggcaagacgaacgagaagtactatgaccaag
gcacttttaaatcttaaagcagaaataaacaaccaatatcaagaattagctcgattgcgc
aagaaaaaagacgatatcgaacatcttcgggattctacaatatctgatatatactctgga
tcttactctacgaatcatttacaaaagcactcgatgaggattagagcgaatactcaactt
agagaaattgacaattcaataaaaagagttgagaagcatatttttgacctcaagcaacag
ttcgacaagaaaaggcaaagatcactcacaacatccagctcaataaaggctgacgtgggg
agcatcaggaatgatgatggccaaaataacgatagtgaagaattgggcgaccatgatagt
ttgacagatcaagttactcttgatgatgaatatcttacgactcccacttctggaactgag
cgtaatagtcagcagaacttaaatcgtaatagtaccgtcaactcacggaataacgaaaat
cattctacgctttccattccagatttagatggatctaataaagtaaacttaaccggtgat
actgaaaaagatcttggtgatcttgaaaacgaaaatcaaatattcacatccacaacaact
gaagcggcaacatggcttgtaagcgattatatgcaaagttttcaagaaaagaacgtcaac
cctgatttcattgctcaaaaagcaaatggcctggtcaccttattgaaagaacattcagag
ataagaaaagatctggttttaacttcattcatgtcatcaattcaaaatctgcttctcaat
ggaaacaagcttatagcagcatctgcttatagggtatgtcgttacctaataaatagctcg
attttcattgatgagctgttagagctaagactggatgcattcataattatttcccttgcg
aaggataattcttttcaaatagaaagggaacaagccttaaaaatggtacgaagattcatt
gaatacaacaacggtgttactcaaggcattatgcaggctataataagctgtgttgaaaaa
cctgaagactccttaaggcacatggcattagaaactttgttggaactttgttttgtcgcc
cctgaaatggttaaagaatgccgtggtatgagagtgatcgagggatttttacaagattat
acttctttttcactcgcatcagtaatacttgatactattttacaattaatggctacacac
aagacaaggcaacattttctggaagatttcaatgtatctgtgttaaccacggtcttttcg
gatacaaatacaaagtcaaacgttaatgtggaaaaaatgcaaaacgcttctacacttatc
tcaataactttgaacagctacaatggctttatgcttttttctaacaacaatttcaaaccg
ttaaaacagctggtgtcattcttccaaattcctatatgcgcccaatatcttatcgacatc
tttcttgatgttttgaaaatcaaaccactaccatacaagccaaggggcagacattctcat
tctttcaaaccaatcccatctcagtactacaaagagtgtatgtctgtgaatcaacggcta
gccttaattgtgctaattctggagaactcggaatttgtaccccacctccttgaacttttg
aacgaagaagatagagatgatcacttggtagcaaaaggcagatatcttcttaccgaatat
tttaatttaagaatgaatttagtcgataaaaagtatacttcagtatcaaaaccaatttac
aaggagaacttcacttacgtcaatgaaacattccagttcaagaagatcgcttataaaatg
aatagaaacaggaatacaattggcatgtcgggcattgattatgctcaaaatataaaatca
ttttccaaaaatattaaagagaatactcttctccgcgaagtagatgatttccgatttaga
agaatggtttatgactctaaagttttgcaaacgaaggattttacgcgatggaattggaac
ataattaacgaattacttgaaggaccattactaaataaaaagcaactagaagaattagtt
aaatcaaccaaattcatcagaagacttttggtgttttacagaccactcagattgagattt
tccaacgtcaataaaggcgcaaaattatctcaaaagtatgtacaagttggatgccagttt
ttcaaaacactaacggcgactccagaaggaatgaaaatccttatggatgatacaaaaatt
ataccgcaactggcgtctttaatgtttagagcaatggagggaaatatatcaggcaacatc
ttcaacaagaataaactacgagaaaaaataatatttggatacttcaaattcatcggaata
ttgacgcagtcaaagaatggggttcatatcctaacgaggtggaatttttttaccgtaatc
tataagatgtttcaatttgaatcgaaactggggcttgagtttctattattaacaatacca
gaattagatttgaaatattcatcacattgccgcgtcattatcggcaaggcccttgtagtg
gccaatgagaaagttaggattgaggctacaaagcatataggcgataaactaaaagaactg
ttatccacgaaagaaagtgatcttaagttaaaagcgaataaagtgaaactgcagcaattc
aaaatggaaatgttaacaaggcaactatacgacctgagccccagcgtagtcgccgtagca
gaccaagctttatatgaatgtattgtcgcgggcaatggctctgaagagctgggcacctca
tttaggatgtttttaaaccaaatggtattcattaggtctccaatacttttcgagttatta
agccgcccatacgggttccagttgttgaacgaaatcaattttgtgaaggaggaaagggat
tcgtggttatctaaaaaaaacattgagtatgttcatattgtggaggaattcctgaagaaa
aatgaatcaattaatgcaaaatccctcacatttcaacaaaagagtcgcctgccattgcat
ttttatgaaagtctaacgaaaacagaagacggaatattactattaagccaaacaggagat
ttggttactttcatgaacgttataaaaaaatacgtcaacggaaacaatatggccacagta
gaaaatgccaaagaaattctcgacttaaaagcagcattatggtgtgttgggtttatcgga
tccacagaattggggataggtctactagataactactcattggtggaagatattatcgag
gtggcctacaatgccagcgtaaccagcgttaggtttacagcattttatgttctgggatta
atcagcatgacccgcgagggttgcgaaattctagacgagatgggatggaactgttgtgtc
agtgtacaagatgagcctatcgggatcgcactaccaaataggctcgatagatttctatcg
tataacgaacacaaatggtccgcatttggcgagtattctgatgagatgattgtttttaat
aaaagcgatggcgacttgatagaaaaatgcttacccatcgaatttgatttggacaaacta
ctcaaagagaaagataccgcagagaatccattaaatgaaaaaatcattactaataaatac
gacaacgatatcacaagtcaaactatcactgtttcaggtgaaaatagtagtcttttcgca
aacgaaggcctttcttctccctatgttacacaataccgcaatgacgatgactccatcgag
agcaaggtactacatatagtaagtcagctaggcaatcatatcctttcaaatcacgcagtg
aaggagattacagaaataaacaataaatacggtccaaggctttttgaaaacgagaaaatg
ttcttcaaagtatttaatatgatgtcgaagtatcggtttaagccacatgttaggaagttt
ctttgcggactatttattaacaatagagcgcttgaaaatgtcatcaggcacgacaacaaa
agggacaaaaggccggctaattttacacgttag

DBGET integrated database retrieval system