KEGG   Saccharomyces cerevisiae (budding yeast): YER095WHelp
Entry
YER095W           CDS       T00005                                 

Gene name
RAD51, MUT5
Definition
(RefSeq) recombinase RAD51
  KO
K04482  DNA repair protein RAD51
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:sce00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    YER095W (RAD51)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:sce04131]
    YER095W (RAD51)
   04121 Ubiquitin system [BR:sce04121]
    YER095W (RAD51)
   03400 DNA repair and recombination proteins [BR:sce03400]
    YER095W (RAD51)
Membrane trafficking [BR:sce04131]
 Protein recycling
  Rab GTPases and associated proteins
   Other Rab GTPase associated proteins
    YER095W (RAD51)
Ubiquitin system [BR:sce04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   BRCC complex
    YER095W (RAD51)
DNA repair and recombination proteins [BR:sce03400]
 Eukaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    BRCA complex
     YER095W (RAD51)
    RecA family proteins
     YER095W (RAD51)
   FA (Fanconi anemia) pathway
    Other FA pathway factors
     YER095W (RAD51)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Rad51 RecA AAA_25 HHH_5 ATPase DnaB_C AAA_24
Motif
Other DBs
NCBI-GeneID: 856831
NCBI-ProteinID: NP_011021
SGD: S000000897
UniProt: P25454
Structure
PDB: 

Position
V:349980..351182
Genome map
AA seq 400 aa AA seqDB search
MSQVQEQHISESQLQYGNGSLMSTVPADLSQSVVDGNGNGSSEDIEATNGSGDGGGLQEQ
AEAQGEMEDEAYDEAALGSFVPIEKLQVNGITMADVKKLRESGLHTAEAVAYAPRKDLLE
IKGISEAKADKLLNEAARLVPMGFVTAADFHMRRSELICLTTGSKNLDTLLGGGVETGSI
TELFGEFRTGKSQLCHTLAVTCQIPLDIGGGEGKCLYIDTEGTFRPVRLVSIAQRFGLDP
DDALNNVAYARAYNADHQLRLLDAAAQMMSESRFSLIVVDSVMALYRTDFSGRGELSARQ
MHLAKFMRALQRLADQFGVAVVVTNQVVAQVDGGMAFNPDPKKPIGGNIMAHSSTTRLGF
KKGKGCQRLCKVVDSPCLPEAECVFAIYEDGVGDPREEDE
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atgtctcaagttcaagaacaacatatatcagagtcacagcttcagtacgggaacggttcg
ttgatgtccactgtaccagcagacctttcacagtcagtcgttgatggaaacggcaacggt
agcagcgaagatattgaggccaccaacggctccggcgatggtggcggattgcaggagcaa
gcggaagcgcaaggtgaaatggaggatgaagcatacgatgaagctgccttaggttcgttt
gtgccaatagaaaaactgcaagtgaacgggattactatggcggatgtgaaaaaactaagg
gagagtgggcttcacactgctgaagcggtagcatatgctcccagaaaggatttattggaa
atcaaaggtatatcggaagctaaggcagataagttgctaaacgaagcggcaaggctagtg
cctatgggatttgtcacggctgctgattttcatatgagaagatcggagctgatttgtttg
acaacgggttctaagaatttggacactcttttgggtggtggtgtggaaactggttctatt
actgagcttttcggtgaattcaggacaggtaagtcccagctatgtcacactttggccgtg
acatgccaaattccattggatattggtggcggtgaaggtaagtgtttgtatatcgatacc
gaaggtactttcaggccggtaagattggtatccatagctcagcggttcggattagacccg
gatgatgctttgaacaacgttgcgtatgcaagagcctataacgccgatcatcagttaaga
cttctggatgctgctgcccaaatgatgagcgagtctcggttttccttgattgtggtcgat
tctgttatggctctataccgtacggatttttctggtcgtggtgaactaagcgcaaggcaa
atgcatttagccaaatttatgcgtgctttgcaaaggctggccgaccaatttggtgttgca
gtcgtcgttactaaccaagtggtcgcccaagttgatggtggtatggcttttaatccagat
ccaaagaagcctatcggtggtaatattatggcacattcttccaccacgcgattaggtttc
aaaaagggtaagggatgtcaaagattatgcaaagttgttgactcaccttgcttaccagag
gctgaatgtgtgttcgcgatctatgaagatggtgttggtgaccccagagaagaagacgag
tag

DBGET integrated database retrieval system