KEGG   Saccharomyces cerevisiae (budding yeast): YER117WHelp
Entry
YER117W           CDS       T00005                                 

Gene name
RPL23B
Definition
(RefSeq) ribosomal 60S subunit protein L23B
  KO
K02894  large subunit ribosomal protein L23e
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce03010  Ribosome
Module
sce_M00177  Ribosome, eukaryotes
Brite
KEGG Orthology (KO) [BR:sce00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    YER117W (RPL23B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:sce03011]
    YER117W (RPL23B)
Ribosome [BR:sce03011]
 Ribosomal Proteins
  Eukaryotes
   Large subunit
    YER117W (RPL23B)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L14
Motif
Other DBs
NCBI-GeneID: 856853
NCBI-ProteinID: NP_011042
SGD: S000000919
UniProt: P0CX41 P0CX42
Structure
PDB: 

Position
V:join(396769..396810,397282..397653)
Genome map
AA seq 137 aa AA seqDB search
MSGNGAQGTKFRISLGLPVGAIMNCADNSGARNLYIIAVKGSGSRLNRLPAASLGDMVMA
TVKKGKPELRKKVMPAIVVRQAKSWRRRDGVFLYFEDNAGVIANPKGEMKGSAITGPVGK
ECADLWPRVASNSGVVV
NT seq 414 nt NT seq  +upstreamnt  +downstreamnt
atgtcaggtaacggtgctcaaggtacaaaattcagaatttctttaggtttaccagttggt
gctatcatgaactgtgctgacaacagtggtgccagaaacttgtacatcattgccgtcaaa
ggttctggttctagattgaacagattaccagccgcctctttaggtgacatggttatggcc
actgttaaaaagggtaagccagaattgagaaagaaggttatgccagctattgttgtccgt
caagctaagtcttggagaagaagagacggtgtctttttgtacttcgaggacaatgctggt
gtcatcgctaatcctaagggtgaaatgaagggttctgccattactggtccagtcggtaag
gaatgtgccgacttatggccaagagttgcttccaactctggtgttgttgtttaa

DBGET integrated database retrieval system