KEGG   Saccharomyces cerevisiae (budding yeast): YER162CHelp
Entry
YER162C           CDS       T00005                                 

Gene name
RAD4
Definition
(RefSeq) Rad4p
  KO
K10838  xeroderma pigmentosum group C-complementing protein
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce03420  Nucleotide excision repair
Brite
KEGG Orthology (KO) [BR:sce00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03420 Nucleotide excision repair
    YER162C (RAD4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:sce03400]
    YER162C (RAD4)
DNA repair and recombination proteins [BR:sce03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    GGR (global genome repair) factors
     XPC-HR23B-CETN2 complex
      YER162C (RAD4)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Rad4 BHD_3 BHD_1 BHD_2 Transglut_core
Motif
Other DBs
NCBI-GeneID: 856909
NCBI-ProteinID: NP_011089
SGD: S000000964
UniProt: P14736
Structure
PDB: 

Position
V:complement(500630..502894)
Genome map
AA seq 754 aa AA seqDB search
MNEDLPKEYFELIRKALNEKEAEKAPLSRRRRVRRKNQPLPDAKKKFKTGLNELPRESVV
TVNLDSSDDGVVTVPTDDSVEEIQSSEEDYDSEEFEDVTDGNEVAGVEDISVEIKPSSKR
NSDARRTSRNVCSNEERKRRKYFHMLYLVCLMVHGFIRNEWINSKRLSRKLSNLVPEKVF
ELLHPQKDEELPLRSTRKLLDGLKKCMELWQKHWKITKKYDNVGLYMRTWKEIEMSANNK
RKFKTLKRSDFLRAVSKGHGDPDISVQGFVAMLRACNVNARLIMSCQPPDFTNMKIDTSL
NGNNAYKDMVKYPIFWCEVWDKFSKKWITVDPVNLKTIEQVRLHSKLAPKGVACCERNML
RYVIAYDRKYGCRDVTRRYAQWMNSKVRKRRITKDDFGEKWFRKVITALHHRKRTKIDDY
EDQYFFQRDESEGIPDSVQDLKNHPYYVLEQDIKQTQIVKPGCKECGYLKVHGKVGKVLK
VYAKRDIADLKSARQWYMNGRILKTGSRCKKVIKRTVGRPKGEAEEEDERLYSFEDTELY
IPPLASASGEITKNTFGNIEVFAPTMIPGNCCLVENPVAIKAARFLGVEFAPAVTSFKFE
RGSTVKPVLSGIVVAKWLREAIETAIDGIEFIQEDDNRKEHLLGALESWNTLLLKLRIRS
KLNSTYGKIAEEEPNVTKEQNIADNHDNTETFMGGGFLPGIANHEARPYSEPSEPEDSLD
YVSVDKAEESATDDDVGEDYSDFMKELEMSEESD
NT seq 2265 nt NT seq  +upstreamnt  +downstreamnt
atgaatgaagacctgcccaaggaatattttgaactaataaggaaggctcttaacgagaaa
gaggcagaaaaagcgcccctgagtagaagaagaagagtcagaaggaagaaccagccccta
ccagatgccaagaagaagtttaaaacagggttgaatgaattgccacgagaaagcgttgtt
actgtaaacttagattcttcagatgatggcgtcgttacggtaccgacggatgatagtgta
gaggaaatccagtcatctgaagaagattatgattcggaggaatttgaagacgtgacagat
ggaaatgaggtggccggtgtagaagatatatctgttgaaattaagccctctagtaaaagg
aatagtgatgctagaaggacaagccgcaacgtttgttctaatgaagaacggaaaaggaga
aaatatttccacatgttgtatctagtttgcttgatggttcatggatttatacgaaatgaa
tggattaacagcaagcgcttgtctagaaaactgagcaacttagttcctgagaaagtgttt
gagctactgcatcctcagaaagatgaggaactcccacttaggagtactaggaaattatta
gatgggttgaagaaatgcatggagttatggcaaaaacactggaagatcactaaaaaatat
gataatgtgggactttatatgagaacctggaaagaaattgaaatgagcgccaataacaaa
agaaaattcaagacgttgaaaagatctgactttttaagggccgtcagtaaaggtcacgga
gatcctgatatttcagtgcaaggtttcgttgcgatgctcagggcttgtaatgttaacgca
cgacttatcatgtcatgtcaaccgccagattttaccaatatgaagattgacacttctttg
aatggaaacaatgcgtacaaagatatggtcaagtatccgattttttggtgtgaagtgtgg
gacaaattctctaagaaatggataactgttgacccagtaaatctcaaaaccattgaacag
gtcagacttcattccaagttggcaccgaaaggcgtggcgtgctgcgaaagaaatatgttg
aggtacgtgattgcttacgatcggaagtatggctgtagagatgtaactcgaagatatgcc
caatggatgaactctaaagtaagaaaaagaagaattactaaagatgactttggtgagaaa
tggttcagaaaagtgataacagcacttcaccatagaaagagaaccaaaattgatgattac
gaagatcaatatttttttcagagagatgaaagtgaaggcataccagattcggtgcaggat
ttgaaaaaccacccatattatgttttagaacaagatatcaaacagactcaaattgtaaag
ccaggatgtaaagagtgtggatatttaaaagtacatggaaaagttgggaaggttttgaaa
gtttatgcaaaaagagatattgcggatttgaaaagtgctagacaatggtacatgaacggc
cgaattttaaaaactggtagcaggtgtaaaaaggtgataaagaggacagttggaaggcct
aagggcgaagcagaagaagaagatgaaagattatatagctttgaagacacagaattatac
atccctccattagccagtgcgagcggtgaaataaccaagaatacatttggaaacatcgaa
gtttttgcaccaacgatgatacctggtaactgttgtttggttgagaatcctgtggcaatt
aaagctgctaggtttttgggggtggaatttgcacctgctgtaacttcttttaagtttgaa
cgcggcagtacagttaagccagttttaagtggcattgttgttgcaaagtggctcagagaa
gctattgaaaccgctattgatggaatagagtttattcaagaggatgataataggaaggaa
catttgcttggtgctttggagagttggaatactttactgctaaaactgcgtattcgtagc
aagctgaactccacatatggtaaaattgccgaggaagaacctaacgttacgaaggaacag
aatattgcggacaatcacgataatacggagacttttatgggaggtgggttcctaccaggt
atagcaaaccacgaagcaaggccgtatagtgaaccttcagagccagaagatagtttagat
tatgtttctgttgacaaagcggaggaaagtgctacagacgacgatgtcggggaggattat
tcggattttatgaaagaactagagatgtcagaggaatcagactga

DBGET integrated database retrieval system