KEGG   Saccharomyces cerevisiae (budding yeast): YER163CHelp
Entry
YER163C           CDS       T00005                                 

Gene name
GCG1
Definition
(RefSeq) gamma-glutamylcyclotransferase
  KO
K07232  glutathione-specific gamma-glutamylcyclotransferase [EC:4.3.2.7]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce00480  Glutathione metabolism
sce01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sce00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    YER163C (GCG1)
Enzymes [BR:sce01000]
 4. Lyases
  4.3  Carbon-nitrogen lyases
   4.3.2  Amidine-lyases
    4.3.2.7  glutathione-specific gamma-glutamylcyclotransferase
     YER163C (GCG1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ChaC DUF484
Motif
Other DBs
NCBI-GeneID: 856910
NCBI-ProteinID: NP_011090
SGD: S000000965
UniProt: P32656
Structure
PDB: 

Position
V:complement(503084..503782)
Genome map
AA seq 232 aa AA seqDB search
MTNDNSGIWVLGYGSLIYKPPSHYTHRIPAIIHGFARRFWQSSTDHRGTPANPGRVATLI
PYEDIIRQTAFLKNVNLYSESAPIQDPDDLVTIGVVYYIPPEHAQEVREYLNVREQNGYT
LHEVEVHLETNREHEAELGEALEQLPRHNKSGKRVLLTSVYIGTIDNEAFVGPETVDETA
KVIAVSHGPSGSNYEYLAKLEQALAQMPIMKERGRITDHYLTALLETVNKYR
NT seq 699 nt NT seq  +upstreamnt  +downstreamnt
atgactaatgacaacagtggtatctgggtcctaggctacggatctctgatttacaagcct
ccgtctcattacacgcatagaataccggcaataattcacggttttgctcgtcggttctgg
caaagttccactgatcataggggtacacctgcaaacccaggaagagtggccacactaatc
ccgtatgaggatattataaggcaaactgccttcttgaagaatgtgaatttgtatagtgaa
agtgcacctatccaggatcccgacgacttagtcaccataggggtagtgtattatatacca
ccagaacatgctcaagaggttagagagtatttgaacgtaagagaacaaaacgggtacact
ctacatgaggttgaggtgcatctagaaactaatcgggagcacgaggcagaattgggtgaa
gcattagaacagttgcctcggcacaacaaatcgggtaaacgggtactacttacttcggtg
tacattggtacaatagataatgaggccttcgtcggaccagagaccgtggatgaaactgcg
aaagtaattgccgtgtcgcatggacctagtggatctaactatgaataccttgcaaaactg
gagcaagcgctagcgcaaatgcccatcatgaaagagcgagggcgtattaccgatcattat
ctgactgctctattggagactgtaaataaatacaggtga

DBGET integrated database retrieval system