KEGG   Saccharomyces cerevisiae (budding yeast): YER164WHelp
Entry
YER164W           CDS       T00005                                 

Gene name
CHD1
Definition
(RefSeq) chromatin-remodeling ATPase CHD1
  KO
K11367  chromodomain-helicase-DNA-binding protein 1 [EC:3.6.4.12]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Brite
KEGG Orthology (KO) [BR:sce00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:sce03021]
    YER164W (CHD1)
   03036 Chromosome and associated proteins [BR:sce03036]
    YER164W (CHD1)
Enzymes [BR:sce01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     YER164W (CHD1)
Transcription machinery [BR:sce03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     YER164W (CHD1)
Chromosome and associated proteins [BR:sce03036]
 Eukaryotic Type
  Histone modification proteins
   HAT complexes
    SAGA complex
     YER164W (CHD1)
    SLIK complex
     YER164W (CHD1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SNF2_N Cdh1_DBD_1 DUF4208 Chromo Helicase_C ResIII HDA2-3 Myb_DNA-binding Myb_DNA-bind_6 SLIDE CHDCT2
Motif
Other DBs
NCBI-GeneID: 856911
NCBI-ProteinID: NP_011091
SGD: S000000966
UniProt: P32657
Structure
PDB: 

Position
V:505392..509798
Genome map
AA seq 1468 aa AA seqDB search
MAAKDISTEVLQNPELYGLRRSHRAAAHQQNYFNDSDDEDDEDNIKQSRRKRMTTIEDDE
DEFEDEEGEEDSGEDEDEEDFEEDDDYYGSPIKQNRSKPKSRTKSKSKSKPKSQSEKQST
VKIPTRFSNRQNKTVNYNIDYSDDDLLESEDDYGSEEALSEENVHEASANPQPEDFHGID
IVINHRLKTSLEEGKVLEKTVPDLNNCKENYEFLIKWTDESHLHNTWETYESIGQVRGLK
RLDNYCKQFIIEDQQVRLDPYVTAEDIEIMDMERERRLDEFEEFHVPERIIDSQRASLED
GTSQLQYLVKWRRLNYDEATWENATDIVKLAPEQVKHFQNRENSKILPQYSSNYTSQRPR
FEKLSVQPPFIKGGELRDFQLTGINWMAFLWSKGDNGILADEMGLGKTVQTVAFISWLIF
ARRQNGPHIIVVPLSTMPAWLDTFEKWAPDLNCICYMGNQKSRDTIREYEFYTNPRAKGK
KTMKFNVLLTTYEYILKDRAELGSIKWQFMAVDEAHRLKNAESSLYESLNSFKVANRMLI
TGTPLQNNIKELAALVNFLMPGRFTIDQEIDFENQDEEQEEYIHDLHRRIQPFILRRLKK
DVEKSLPSKTERILRVELSDVQTEYYKNILTKNYSALTAGAKGGHFSLLNIMNELKKASN
HPYLFDNAEERVLQKFGDGKMTRENVLRGLIMSSGKMVLLDQLLTRLKKDGHRVLIFSQM
VRMLDILGDYLSIKGINFQRLDGTVPSAQRRISIDHFNSPDSNDFVFLLSTRAGGLGINL
MTADTVVIFDSDWNPQADLQAMARAHRIGQKNHVMVYRLVSKDTVEEEVLERARKKMILE
YAIISLGVTDGNKYTKKNEPNAGELSAILKFGAGNMFTATDNQKKLEDLNLDDVLNHAED
HVTTPDLGESHLGGEEFLKQFEVTDYKADIDWDDIIPEEELKKLQDEEQKRKDEEYVKEQ
LEMMNRRDNALKKIKNSVNGDGTAANSDSDDDSTSRSSRRRARANDMDSIGESEVRALYK
AILKFGNLKEILDELIADGTLPVKSFEKYGETYDEMMEAAKDCVHEEEKNRKEILEKLEK
HATAYRAKLKSGEIKAENQPKDNPLTRLSLKKREKKAVLFNFKGVKSLNAESLLSRVEDL
KYLKNLINSNYKDDPLKFSLGNNTPKPVQNWSSNWTKEEDEKLLIGVFKYGYGSWTQIRD
DPFLGITDKIFLNEVHNPVAKKSASSSDTTPTPSKKGKGITGSSKKVPGAIHLGRRVDYL
LSFLRGGLNTKSPSADIGSKKLPTGPSKKRQRKPANHSKSMTPEITSSEPANGPPSKRMK
ALPKGPAALINNTRLSPNSPTPPLKSKVSRDNGTRQSSNPSSGSAHEKEYDSMDEEDCRH
TMSAIRTSLKRLRRGGKSLDRKEWAKILKTELTTIGNHIESQKGSSRKASPEKYRKHLWS
YSANFWPADVKSTKLMAMYDKITESQKK
NT seq 4407 nt NT seq  +upstreamnt  +downstreamnt
atggcagccaaggatatttctactgaagtgctgcaaaatcctgaactatatgggctgagg
cggtcacatagagctgctgcgcatcaacaaaactacttcaacgatagcgatgatgaggac
gatgaagataatattaaacagtcgaggaggaagagaatgaccacgattgaagacgacgaa
gacgaatttgaagatgaagaaggcgaagaagattctggagaggacgaagatgaggaagat
tttgaagaagatgatgattattatggctctcctataaaacaaaatcgatcaaaaccgaaa
tcaagaacaaaatcaaagtctaaatctaagccaaaatctcaatctgaaaagcaatctaca
gtgaaaataccaacaaggttttctaatcgtcaaaacaaaacggtaaattataacatcgat
tatagcgatgatgacctcttagaatctgaagatgactatggttccgaggaggctttatca
gaggaaaatgtgcatgaagcatctgccaatcctcaaccagaggacttccacggtattgat
attgttatcaatcacagactaaagacatctttggaagaaggaaaggtcttggaaaagact
gttcctgacctcaataactgcaaggaaaattatgaattcttaatcaaatggacagatgaa
tctcatctccacaatacctgggaaacttatgaatccattggccaagtccgtggattgaag
aggttggacaactattgtaagcaattcatcatcgaagatcaacaagtaagattagatcca
tacgttaccgccgaagatatagagatcatggacatggaacgtgaacgtaggcttgatgaa
tttgaggagttccacgtgccagaaaggattattgatagccaacgtgcttcgttggaagac
ggcacctcacaattacagtatttagttaaatggcgtcgtctaaattacgacgaggctact
tgggagaatgccacagatatcgtgaaattggcacctgaacaagtgaaacattttcaaaac
agagaaaactctaagatcctcccacaatattccagtaattatacttcacagagaccgcgt
tttgagaagttaagcgtgcaacctccgttcattaaaggtggggaattaagagattttcaa
ctaactggtattaattggatggcatttttgtggtccaaaggtgataatggtatactggca
gatgagatgggcctgggaaaaacggtccagactgtcgcctttatcagttggctgatattt
gctcgtagacaaaacggacctcacatcattgtcgttcctttatcgacaatgcctgcctgg
ttggatacttttgagaaatgggcgcctgatttgaattgtatatgctatatgggcaaccaa
aaatcaagagataccattcgagaatatgaattttacaccaatccaagggcaaaagggaaa
aaaacaatgaaatttaatgttttattaacaacatacgagtacatcttaaaggatcgtgct
gaattaggaagtataaaatggcaatttatggccgttgacgaagctcatagactaaaaaat
gctgaatcatccctttatgaatcattaaacagtttcaaggtcgccaaccgtatgttaatc
acaggcacacctcttcagaataatattaaagagttagctgcgttggttaatttcctaatg
cccggaaggtttacgattgatcaggagattgattttgaaaaccaagatgaagagcaagaa
gaatatattcatgatttacaccgaagaatacagccttttattcttcgtcggttgaagaaa
gacgtagaaaaatcacttccatcaaagacagagcgtattttaagagttgaattgtccgac
gtacagactgagtactataaaaatattctgactaaaaactactctgctttaactgctgga
gctaaagggggtcatttctctttactgaatattatgaacgagttgaaaaaggcatcgaac
catccatatctcttcgataatgctgaagagcgcgtcttacagaaatttggggatggtaaa
atgactcgagaaaacgtactaagaggtttgatcatgtcttcgggtaagatggttctttta
gaccaattattgaccagattgaagaaagatgggcaccgcgtgttgattttttcacaaatg
gtcagaatgcttgacattttaggcgactatttatccattaaaggtattaacttccaaagg
ttagatggtacagtaccatctgctcaaagaaggatatctattgatcatttcaactctccg
gattcaaacgacttcgtatttttactttctactcgtgctggtggtttgggtatcaactta
atgaccgccgataccgttgtgatttttgattccgattggaatccgcaagccgatttacaa
gcaatggctagagctcatcgtattggccaaaaaaatcacgttatggtgtataggttggtt
tcaaaagacacagtagaggaagaggtattagaaagagcacggaagaaaatgattctggaa
tatgctattatttctcttggagtgacagatggtaacaaatacactaagaagaatgaacca
aatgccggtgaattatcggcaatcctgaagttcggtgcaggcaatatgttcactgccaca
gacaaccagaaaaaattggaggatcttaacttggatgatgttttgaatcatgcagaggat
cacgttactactccagacttaggagagtcgcatcttggcggtgaagagtttttgaagcaa
ttcgaagtgactgattataaagctgatatagattgggatgatatcattccagaagaagaa
ctaaaaaaactccaagatgaagagcagaaacgcaaggatgaagaatatgttaaagaacaa
cttgaaatgatgaatagaagggataacgccctaaaaaaaataaaaaacagtgttaatggt
gatgggaccgccgcaaactcagattctgacgacgatagtacttccagatcttctagaaga
agagcaagagctaatgacatggactctattggtgaatcggaggtgagagctttgtataaa
gctattttaaaatttggcaacctaaaggagattttggacgagttgattgcagatggaacc
ctgccggtcaaatcatttgaaaaatacggtgaaacttacgatgaaatgatggaagcagct
aaagactgtgtacacgaggaagagaaaaatagaaaagaaatcttggagaaacttgagaag
catgctaccgcctatagagcaaagctaaaaagcggtgaaataaaagcagagaaccaacca
aaggataatccgttgactagattatctttaaaaaaaagagaaaagaaagccgtccttttc
aactttaaaggtgttaaatctttaaacgccgaatctttactaagtagagtggaggattta
aagtacttgaagaacttgataaattcaaactacaaagatgatccattaaagtttagccta
ggcaacaacacacctaagcctgtacagaattggtcatctaattggacgaaagaggaagat
gagaagctattgattggtgttttcaaatatggatatggttcctggacacaaataagagac
gatccatttctaggcattactgataaaatattcttgaatgaagttcacaatccggtagca
aaaaagtcggcaagctcctctgatacaacaccaacaccctcaaagaaaggaaagggaata
acgggttcttcaaaaaaagtacctggtgccattcacttgggcagaagagttgattatcta
ttatccttcttaagaggaggcctaaatacaaagagtcccagtgctgacataggctcgaaa
aaactccctactggtccttccaaaaagagacaaagaaaacctgctaatcacagcaaatcc
atgactccagaaattacaagttctgagcctgcaaatggcccgccaagcaaacgtatgaaa
gccctcccaaaaggtcctgccgccttaataaataacacgagattgtctccaaacagcccc
acgcccccattaaagtccaaggtttccagagataatggtacaaggcaatcaagcaacccc
agtagcggcagcgctcacgaaaaagaatatgacagcatggatgaagaagactgtcgacac
acaatgagtgcaatacgtacttctttgaagcgacttagaagaggcggcaaaagtcttgat
cgtaaggaatgggccaaaattttgaagaccgaattaactacgattggtaatcatatcgaa
tcgcaaaagggctcatcgagaaaggcaagcccagaaaaatatcgcaagcacctttggtct
tacagtgccaacttttggcctgccgacgttaagagtacaaagctgatggcaatgtacgac
aagataacagagtctcaaaagaagtga

DBGET integrated database retrieval system