KEGG   Saccharomyces cerevisiae (budding yeast): YER165WHelp
Entry
YER165W           CDS       T00005                                 

Gene name
PAB1
Definition
(RefSeq) polyadenylate-binding protein
  KO
K13126  polyadenylate-binding protein
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce03013  RNA transport
sce03015  mRNA surveillance pathway
sce03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:sce00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    YER165W (PAB1)
   03015 mRNA surveillance pathway
    YER165W (PAB1)
  09123 Folding, sorting and degradation
   03018 RNA degradation
    YER165W (PAB1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:sce03019]
    YER165W (PAB1)
   03041 Spliceosome [BR:sce03041]
    YER165W (PAB1)
Messenger RNA biogenesis [BR:sce03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     YER165W (PAB1)
   mRNA cycle factors
    Stress granule specific factors
     YER165W (PAB1)
Spliceosome [BR:sce03041]
 Complex C
  Other components
   Complex C specific factors
    YER165W (PAB1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RRM_1 PABP RRM_5 RRM_7 RRM_3 RRM_occluded YflT
Motif
Other DBs
NCBI-GeneID: 856912
NCBI-ProteinID: NP_011092
SGD: S000000967
UniProt: P04147
Structure
PDB: 

Position
V:510373..512106
Genome map
AA seq 577 aa AA seqDB search
MADITDKTAEQLENLNIQDDQKQAATGSESQSVENSSASLYVGDLEPSVSEAHLYDIFSP
IGSVSSIRVCRDAITKTSLGYAYVNFNDHEAGRKAIEQLNYTPIKGRLCRIMWSQRDPSL
RKKGSGNIFIKNLHPDIDNKALYDTFSVFGDILSSKIATDENGKSKGFGFVHFEEEGAAK
EAIDALNGMLLNGQEIYVAPHLSRKERDSQLEETKAHYTNLYVKNINSETTDEQFQELFA
KFGPIVSASLEKDADGKLKGFGFVNYEKHEDAVKAVEALNDSELNGEKLYVGRAQKKNER
MHVLKKQYEAYRLEKMAKYQGVNLFVKNLDDSVDDEKLEEEFAPYGTITSAKVMRTENGK
SKGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQRKDVRRSQLAQQIQARNQMRYQ
QATAAAAAAAAGMPGQFMPPMFYGVMPPRGVPFNGPNPQQMNPMGGMPKNGMPPQFRNGP
VYGVPPQGGFPRNANDNNQFYQQKQRQALGEQLYKKVSAKTSNEEAAGKITGMILDLPPQ
EVFPLLESDELFEQHYKEASAAYESFKKEQEQQTEQA
NT seq 1734 nt NT seq  +upstreamnt  +downstreamnt
atggctgatattactgataagacagctgaacaattggaaaacttgaatattcaagatgac
caaaagcaagccgccactggttcagaaagccaatctgttgaaaactcttctgcatcatta
tatgttggtgacttagaaccttctgtttccgaagcccacttatatgatatcttctctcca
atcggttcagtctcctccattcgtgtctgtcgtgatgccatcactaagacctctttgggc
tatgcttatgttaactttaacgaccatgaagccggcagaaaagcaattgagcaattgaac
tacactccaatcaagggtagattatgccgtattatgtggtctcaacgtgacccatcattg
agaaagaagggttctggtaacatctttatcaagaacttgcaccctgatattgacaacaag
gctttgtatgacactttctctgtgtttggtgacatcttgtccagcaagattgccaccgac
gaaaacggaaaatccaagggttttgggtttgttcacttcgaagaagaaggtgctgccaag
gaagctattgatgctttgaatggtatgctgttgaacggtcaagaaatttatgttgctcct
cacttgtccagaaaggaacgtgactctcaattggaagagactaaggcacattacactaac
ctttatgtgaaaaacatcaactccgaaactactgacgaacaattccaagaattgtttgcc
aaatttggtccaattgtttctgcctctttggaaaaggatgctgatggaaaattgaagggt
ttcgggtttgttaactacgaaaagcatgaagacgctgtgaaagctgttgaagctttgaat
gactctgaactaaatggagaaaagttatacgttggtcgtgcccaaaagaagaatgaacgt
atgcatgtcttgaagaagcaatacgaagcttacagattggaaaaaatggccaagtaccaa
ggtgttaatttgtttgttaagaacttagatgacagcgttgatgacgaaaagttggaagaa
gaatttgctccatatggtactatcacttctgcaaaggttatgagaaccgaaaacggtaag
tctaagggttttggttttgtttgtttctcaactccagaggaagctactaaggccattaca
gaaaagaaccaacaaattgttgctggtaagccattatacgttgccattgctcaaagaaaa
gacgtaagacgttctcaattggctcaacaaatccaagccagaaatcaaatgagataccag
caagctactgctgccgctgccgccgccgctgccggtatgccaggtcaattcatgcctcca
atgttctatggtgttatgccaccaagaggtgttccattcaacggtccaaacccacaacaa
atgaacccaatgggcggtatgccaaagaacggcatgccacctcaatttagaaatggtccg
gtttacggcgtccccccacaaggtggtttcccaagaaatgccaacgataacaaccaattt
tatcaacaaaagcaaagacaagctttgggtgaacaattatacaagaaggtttctgctaag
acttcaaatgaagaagcagctggtaaaattactggtatgattttggatttgccacctcaa
gaggtcttcccattgttggaaagtgatgaattgttcgaacaacactacaaagaagcttct
gctgcctatgagtctttcaaaaaggagcaagaacaacaaactgagcaagcttaa

DBGET integrated database retrieval system