KEGG   Saccharomyces cerevisiae (budding yeast): YER166WHelp
Entry
YER166W           CDS       T00005                                 

Gene name
DNF1
Definition
(RefSeq) aminophospholipid-translocating P4-type ATPase DNF1
  KO
K01530  phospholipid-translocating ATPase [EC:7.6.2.1]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Brite
KEGG Orthology (KO) [BR:sce00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    YER166W (DNF1)
Enzymes [BR:sce01000]
 7. Translocases
  7.6  Catalysing the translocation of other compounds
   7.6.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.6.2.1  P-type phospholipid transporter
     YER166W (DNF1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PhoLip_ATPase_C PhoLip_ATPase_N Cation_ATPase Hydrolase E1-E2_ATPase Hydrolase_3
Motif
Other DBs
NCBI-GeneID: 856913
NCBI-ProteinID: NP_011093
SGD: S000000968
UniProt: P32660
Position
V:512744..517459
Genome map
AA seq 1571 aa AA seqDB search
MSGTFHGDGHAPMSPFEDTFQFEDNSSNEDTHIAPTHFDDGATSNKYSRPQVSFNDETPK
NKREDAEEFTFNDDTEYDNHSFQPTPKLNNGSGTFDDVELDNDSGEPHTNYDGMKRFRMG
TKRNKKGNPIMGRSKTLKWARKNIPNPFEDFTKDDIDPGAINRAQELRTVYYNMPLPKDM
IDEEGNPIMQYPRNKIRTTKYTPLTFLPKNILFQFHNFANVYFLVLIILGAFQIFGVTNP
GLSAVPLVVIVIITAIKDAIEDSRRTVLDLEVNNTKTHILEGVENENVSTDNISLWRRFK
KANSRLLFKFIQYCKEHLTEEGKKKRMQRKRHELRVQKTVGTSGPRSSLDSIDSYRVSAD
YGRPSLDYDNLEQGAGEANIVDRSLPPRTDCKFAKNYWKGVKVGDIVRIHNNDEIPADII
LLSTSDTDGACYVETKNLDGETNLKVRQSLKCTNTIRTSKDIARTKFWIESEGPHSNLYT
YQGNMKWRNLADGEIRNEPITINNVLLRGCTLRNTKWAMGVVMFTGGDTKIMLNSGITPT
KKSRISRELNFSVVINFVLLFILCFVSGIANGVYYDKKGRSRFSYEFGTIAGSAATNGFV
SFWVAVILYQSLVPISLYISVEIIKTAQAAFIYGDVLLYNAKLDYPCTPKSWNISDDLGQ
VEYIFSDKTGTLTQNVMEFKKCTINGVSYGRAYTEALAGLRKRQGIDVETEGRREKAEIA
KDRDTMIDELRALSGNSQFYPEEVTFVSKEFVRDLKGASGEVQQRCCEHFMLALALCHSV
LVEANPDNPKKLDLKAQSPDEAALVATARDVGFSFVGKTKKGLIIEMQGIQKEFEILNIL
EFNSSRKRMSCIVKIPGLNPGDEPRALLICKGADSIIYSRLSRQSGSNSEAILEKTALHL
EQYATEGLRTLCIAQRELSWSEYEKWNEKYDIAAASLANREDELEVVADSIERELILLGG
TAIEDRLQDGVPDCIELLAEAGIKLWVLTGDKVETAINIGFSCNLLNNEMELLVIKTTGD
DVKEFGSEPSEIVDALLSKYLKEYFNLTGSEEEIFEAKKDHEFPKGNYAIVIDGDALKLA
LYGEDIRRKFLLLCKNCRAVLCCRVSPSQKAAVVKLVKDSLDVMTLAIGDGSNDVAMIQS
ADVGIGIAGEEGRQAVMCSDYAIGQFRYLARLVLVHGRWSYKRLAEMIPEFFYKNMIFAL
ALFWYGIYNDFDGSYLYEYTYMMFYNLAFTSLPVIFLGILDQDVNDTISLVVPQLYRVGI
LRKEWNQRKFLWYMLDGLYQSIICFFFPYLVYHKNMIVTSNGLGLDHRYFVGVYVTTIAV
ISCNTYVLLHQYRWDWFSGLFIALSCLVVFAWTGIWSSAIASREFFKAAARIYGAPSFWA
VFFVAVLFCLLPRFTYDSFQKFFYPTDVEIVREMWQHGHFDHYPPGYDPTDPNRPKVTKA
GQHGEKIIEGIALSDNLGGSNYSRDSVVTEEIPMTFMHGEDGSPSGYQKQETWMTSPKET
QDLLQSPQFQQAQTFGRGPSTNVRSSLDRTREQMIATNQLDNRYSVERARTSLDLPGVTN
AASLIGTQQNN
NT seq 4716 nt NT seq  +upstreamnt  +downstreamnt
atgtctggaacttttcatggcgatgggcatgctcccatgtcgccctttgaagatacattt
caatttgaagataatagcagtaatgaagatacacatattgcacctacccattttgatgat
ggtgcaacaagcaacaaatacagccggccacaggtcagcttcaatgatgaaacacccaaa
aataaacgtgaagatgcagaagaattcacatttaacgatgacacagaatatgacaatcat
tcctttcagccaacaccgaaacttaataatggatctgggacgtttgatgatgtggaatta
gacaatgatagtggtgaaccgcacactaactacgatggtatgaaaagattccggatgggt
acaaaaaggaataaaaaaggaaacccaataatgggaagatctaagaccttgaaatgggct
aggaagaacattccaaacccatttgaagactttacgaaggatgatattgaccctggtgcc
ataaatcgtgcgcaagaactaaggactgtgtattacaatatgcccttaccaaaagatatg
atagatgaagaaggcaaccccattatgcagtatcctcgtaataaaatcagaactaccaaa
tataccccgttaacattcttaccaaaaaacattctatttcagtttcataatttcgccaac
gtttatttcttagttttaataattttaggtgcatttcaaatttttggtgtcacgaaccct
ggtttaagtgcggttccgttagttgtcattgttataatcactgcgatcaaggatgctatt
gaagactcaagaagaaccgtcctagatttagaggtgaataataccaagacacatatttta
gaaggtgttgagaacgaaaatgtctcaaccgataatatttcattgtggagaaggtttaag
aaagcaaactctagactccttttcaagtttatacaatattgtaaagaacatttaactgaa
gagggcaaaaagaagagaatgcagagaaagcgtcatgaactaagagtacaaaaaactgtt
ggaacgagtggacccagatcctctctagactccattgacagttacagagtatctgcagat
tatggccgtccttcattggattatgataatttggaacaaggggccggtgaagccaatata
gttgatagatccctaccacccagaactgattgtaaatttgccaagaattattggaaaggt
gtcaaggttggtgatattgttcgtatccataacaatgatgaaatccctgctgacattatc
ttactttcaacgtcggatacagatggtgcctgctacgtagaaactaaaaatttggatggt
gaaacaaacttaaaggtacgccaatccttgaagtgtaccaatactataagaacgtcaaaa
gatattgctagaacaaaattctggatcgaaagtgaagggccccactcaaatttgtacact
tatcaaggtaatatgaaatggagaaatcttgcagatggcgagatacgaaatgagccaatt
actattaataacgttctgcttcgtggttgcactcttagaaatactaagtgggcaatgggt
gttgtaatgtttaccggtggtgacacaaaaatcatgttaaactctggcattacacccacc
aagaagtccaggatttcaagagaactaaacttctctgtggtgataaatttcgtgctactt
ttcatcttatgttttgtttctggtattgcaaatggtgtatattacgacaaaaaaggcaga
tcacggttttcctatgaatttggaacaattgctgggtcagcggcgacaaacggtttcgtc
tcattttgggttgctgttattctttaccaatctttagtcccaatctctttgtacatttct
gtggagatcatcaaaactgcacaagcggccttcatttacggagacgttttactctacaat
gccaaattggattatccttgtacaccaaaatcctggaatatttctgacgatttaggtcaa
gtggaatatatattttctgataaaacaggtacattaactcaaaatgtaatggagtttaaa
aaatgtactatcaatggtgtttcatatggaagagcttacaccgaagcgttagcgggatta
agaaaaagacaaggtatcgacgtcgaaaccgaaggtaggcgtgagaaggccgaaattgcc
aaggatagggatacaatgatcgatgaactgagagctttatcaggaaattcacaattttat
cccgaagaagttacctttgtatcaaaggagttcgttcgcgatttgaaaggggctagtggt
gaagtacaacaaagatgctgtgagcactttatgttagcattagctttatgtcactccgtc
cttgtagaagcaaacccggacaatccaaaaaaactggatttaaaagctcaatctccagac
gaagcagcgttagtagccacagctagagatgtaggattcagttttgttggaaaaaccaaa
aaagggttgataattgaaatgcaaggtattcaaaaagaatttgagattctaaatattttg
gagtttaattcatcgagaaaaagaatgtcctgtattgtcaaaattccgggtctgaaccca
ggggacgagcctagagcacttttaatttgtaaaggtgcagattccattatatactcaaga
ttaagtcgccagagtggtagcaatagtgaagctattttggaaaaaactgctttgcattta
gagcagtacgctactgaaggtttaagaacgttatgcatagctcaaagggagttaagttgg
tctgaatacgaaaaatggaacgaaaagtacgatattgctgctgcatcattagcaaacaga
gaggatgaattagaagttgttgcagattccattgaacgcgaattgatattattgggcggt
acagctatcgaagatcgtttacaagatggtgttccggattgtatagagttgcttgcagag
gcaggaattaaattatgggttcttacgggtgataaagttgaaacagctataaacattgga
ttttcttgcaaccttttgaataatgaaatggaattgttagttattaaaacaactggtgat
gacgtgaaagaattcggatcagaaccaagtgaaattgtggatgctttactctccaaatac
ttgaaggagtatttcaacttaaccggttcagaagaagagatttttgaagctaaaaaggat
cacgaatttccgaagggtaattacgccatcgttatcgatggtgatgctttgaaattggcg
ctatatggtgaagatataagaagaaagtttcttttactctgcaagaattgtagagctgtc
ttatgctgtagagtatctccatctcaaaaagcagccgttgttaagttagtcaaggattct
ctagatgtcatgacactagccatcggcgatggttccaacgacgtcgccatgattcaatct
gcggatgttggtattggtattgccggtgaagaaggtcgacaagctgttatgtgctcagac
tacgccattggacaattcagatatttggctagattggtcctcgttcacggtaggtggtct
tataagagactggcagaaatgattcctgagtttttttacaaaaacatgatttttgctttg
gcattgttctggtatggtatctataatgattttgatgggtcttacctgtatgaatacaca
tacatgatgttctataatttggcatttacatccctaccagtcatcttcttaggtattctg
gaccaggacgtgaatgacacaatatcattagtggtccctcagttataccgtgttggaatt
ttaaggaaagaatggaaccaaagaaagttcttatggtatatgttggacggattatatcag
tctattatctgtttttttttcccttacttggtttatcacaaaaatatgatagttacgagc
aatgggttaggattggatcatcgttattttgtcggtgtttatgtgaccactattgctgta
atttcgtgtaacacatatgttttattacaccaatatagatgggattggtttagtggatta
ttcattgcactgtcttgcctcgtagtttttgcatggacgggaatatggtcttctgcgata
gctagtagagaatttttcaaagctgcagcgcgtatctatggagcaccttcattttgggct
gttttctttgttgccgtgctgttctgcttactgccccgtttcacatatgacagttttcaa
aaatttttctacccaactgatgtggaaatagtaagagagatgtggcaacatggccatttc
gatcattatcctcctggttacgatccaacagatcccaacagacccaaggtcacaaaagct
gggcaacacggagagaagattatagaaggcatagcactttccgacaacttaggaggatcg
aactattcaagggatagtgttgtcacagaggagattccaatgactttcatgcacggtgaa
gatggaagtcctagcggatatcagaagcaagaaacctggatgacttcacccaaggaaaca
caagatcttcttcaatcgccccaatttcagcaggcccaaacgttcggaagaggcccatca
accaacgtcaggtcatccttggaccgcacaagagaacagatgatcgccactaaccaacta
gataaccgctactctgtggaaagagcgagaacatctctagatctaccaggcgtaactaac
gcagcctccttaatcggaacacaacagaacaattaa

DBGET integrated database retrieval system