KEGG   Saccharomyces cerevisiae (budding yeast): YER168CHelp
Entry
YER168C           CDS       T00005                                 

Gene name
CCA1, TNT1
Definition
(RefSeq) tRNA adenylyltransferase
  KO
K00974  tRNA nucleotidyltransferase (CCA-adding enzyme) [EC:2.7.7.72 3.1.3.- 3.1.4.-]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce03013  RNA transport
Brite
KEGG Orthology (KO) [BR:sce00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    YER168C (CCA1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:sce03016]
    YER168C (CCA1)
Enzymes [BR:sce01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.72  CCA tRNA nucleotidyltransferase
     YER168C (CCA1)
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.-  
     YER168C (CCA1)
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.-  
     YER168C (CCA1)
Transfer RNA biogenesis [BR:sce03016]
 Eukaryotic Type
  3'processing and CCA adding factors
   CCA adding factors
    YER168C (CCA1)
 Prokaryotic Type
    YER168C (CCA1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PolyA_pol PolyA_pol_RNAbd tRNA_NucTran2_2 Ldi
Motif
Other DBs
NCBI-GeneID: 856915
NCBI-ProteinID: NP_011095
SGD: S000000970
UniProt: P21269
Position
V:complement(521029..522669)
Genome map
AA seq 546 aa AA seqDB search
MLRSTISLLMNSAAQKTMTNSNFVLNAPKITLTKVEQNICNLLNDYTDLYNQKYHNKPEP
LTLRITGGWVRDKLLGQGSHDLDIAINVMSGEQFATGLNEYLQQHYAKYGAKPHNIHKID
KNPEKSKHLETATTKLFGVEVDFVNLRSEKYTELSRIPKVCFGTPEEDALRRDATLNALF
YNIHKGEVEDFTKRGLQDLKDGVLRTPLPAKQTFLDDPLRVLRLIRFASRFNFTIDPEVM
AEMGDPQINVAFNSKISRERVGVEMEKILVGPTPLLALQLIQRAHLENVIFFWHNDSSVV
KFNEENCQDMDKINHVYNDNILNSHLKSFIELYPMFLEKLPILREKIGRSPGFQQNFILS
AILSPMANLQIIGNPKKKINNLVSVTESIVKEGLKLSKNDAAVIAKTVDSICSYEEILAK
FADRSQLKKSEIGIFLRNFNGEWETAHFASLSDAFLKIPKLETKKIELLFQNYNEFYSYI
FDNNLNNCHELKPIVDGKQMAKLLQMKPGPWLGKINNEAIRWQFDNPTGTDQELITHLKA
ILPKYL
NT seq 1641 nt NT seq  +upstreamnt  +downstreamnt
atgctacggtctactatatctctactgatgaatagtgctgctcagaaaacgatgacgaat
tctaattttgttctaaatgcacccaaaatcaccttaaccaaagtggaacagaacatctgt
aacttgctgaacgattatacagacttgtacaatcaaaagtaccacaataagcctgagcca
ttgactcttcggatcacgggcggatgggtgcgtgacaagcttctgggacaaggttctcac
gacttggatattgccatcaatgtgatgtcaggtgagcaatttgctactggtttgaacgag
tatttgcaacaacattacgccaaatatggagccaagcctcataatatccacaagattgac
aagaatcccgagaaatccaagcatctggaaactgccactactaagctctttggcgttgaa
gtggattttgtcaatttaagatctgaaaagtatactgaactttccaggatacctaaagtg
tgctttggcacacccgaggaagacgctttaagaagggatgctacattgaacgctcttttc
tataacattcataaaggtgaagtggaagatttcaccaagagaggtctgcaagatctaaaa
gatggcgttctccgtactccgcttcctgcaaaacaaacatttttggatgatcccttgagg
gttttgaggttgatccgttttgcttctagattcaactttaccatagatccggaagtgatg
gctgaaatgggcgatcctcagattaatgttgcattcaattcaaaaatttctagagagcga
gttggtgtggagatggagaaaatattagtaggaccaacccctttattggctttgcagctg
attcaaagggctcatcttgaaaatgttatctttttttggcataatgatagctccgtcgta
aaattcaacgaagagaattgtcaagatatggacaaaattaatcatgtatacaatgataac
atactaaactcacacttgaaaagttttattgaattatatccaatgtttttagagaagctt
cctatcttaagggaaaaaattggtcgttcgccaggatttcagcaaaattttatattgagt
gcgatcctgtcccccatggctaatttacaaataatcgggaacccaaagaagaaaattaac
aacctggtttcggtgacagaaagcattgtgaaggaaggattgaagctgagtaaaaatgat
gcagcagttattgccaagaccgtagattcaatatgttcatatgaggaaatacttgctaag
tttgcagatcgttcccagctaaaaaaatccgaaatcggtatatttctacggaactttaat
ggcgaatgggaaacagcacattttgcatctctatcagatgcatttttaaagattcccaag
cttgaaactaaaaaaattgaattacttttccaaaattacaatgaattttattcttacata
tttgacaataatttgaataattgtcatgaactaaaaccaatagtggacggaaaacaaatg
gcaaaactacttcaaatgaagccaggtccatggctgggtaaaattaataacgaagcgatt
aggtggcagtttgataatcctacagggactgatcaagaattaataactcatttaaaagcc
atactaccaaaatacctgtag

DBGET integrated database retrieval system