KEGG   Saccharomyces cerevisiae (budding yeast): YER174CHelp
Entry
YER174C           CDS       T00005                                 

Gene name
GRX4
Definition
(RefSeq) monothiol glutaredoxin GRX4
Organism
sce  Saccharomyces cerevisiae (budding yeast)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glutaredoxin Thioredoxin Thioredoxin_8 AhpC-TSA DIM1 OST3_OST6 Thioredoxin_2 TraF Redoxin Thioredoxin_7 SH3BGR
Motif
Other DBs
NCBI-GeneID: 856921
NCBI-ProteinID: NP_011101
SGD: S000000976
UniProt: P32642
Position
V:complement(538434..539168)
Genome map
AA seq 244 aa AA seqDB search
MTVVEIKSQDQFTQLTTTNAANKLIVLYFKAQWADPCKTMSQVLEAVSEKVRQEDVRFLS
IDADEHPEISDLFEIAAVPYFVFIQNGTIVKEISAADPKEFVKSLEILSNASASLANNAK
GPKSTSDEESSGSSDDEEDETEEEINARLVKLVQAAPVMLFMKGSPSEPKCGFSRQLVGI
LREHQIRFGFFDILRDENVRQSLKKFSDWPTFPQLYINGEFQGGLDIIKESIEEDPEYFQ
HALQ
NT seq 735 nt NT seq  +upstreamnt  +downstreamnt
atgactgtggttgaaataaaaagccaggaccaatttacgcaactaaccactacaaacgct
gctaataaactcattgtcttatattttaaagctcaatgggctgatccttgcaaaactatg
agccaggtgctagaagctgttagtgaaaaagttaggcaagaggatgtccggtttttatca
atagatgcagacgaacatccagaaatatcagacctttttgagattgcagccgtaccatac
ttcgtcttcattcaaaatggtactattgtaaaagaaatatcagccgcagatcctaaggag
tttgtgaaaagcttagaaattctttcgaatgcttctgcctcactagcgaacaatgccaag
ggtcctaaatctacgtctgatgaggaaagcagcgggtcttccgatgatgaagaggacgaa
actgaagaagaaataaatgctaggctggtgaagctagtacaagctgcacctgtgatgcta
ttcatgaaaggaagcccatcagaacctaaatgcggattttctagacagttagttggtatc
ctcagagaacaccaaataaggttcggattttttgatatattaagagacgaaaacgttaga
caaagcttgaagaagttttctgattggcctacttttcctcagttatatatcaatggggag
ttccagggaggtttggatattatcaaggaatctatagaagaagatcctgaatatttccaa
catgctctacagtaa

DBGET integrated database retrieval system