KEGG   Saccharomyces cerevisiae (budding yeast): YER176WHelp
Entry
YER176W           CDS       T00005                                 

Gene name
ECM32, HEL1, MTT1
Definition
(RefSeq) Ecm32p
Organism
sce  Saccharomyces cerevisiae (budding yeast)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_12 AAA_11 AAA_19 AAA_30 Viral_helicase1 ResIII PhoH UPF1_Zn_bind UvrD_C_2 AAA DEAD AAA_16 L_protein_N AAA_22
Motif
Other DBs
NCBI-GeneID: 856923
NCBI-ProteinID: NP_011103
SGD: S000000978
UniProt: P32644
Position
V:541690..545055
Genome map
AA seq 1121 aa AA seqDB search
MDFQCRTCSQAYDAEQMMKHLSSTRHKTVFDTSNDEDICCEECQDKNIHQLQIIRFGGED
MVLLCNSCFRKEYSETERPSTSYSLQNGSILKFWEKYVKVRECCCDECGEESNLNANRNG
EVLCDKCLPKSNRAKDFVSEKSGRFLYIYLGLNETQNSTRKPRKKGGRRVGRGKKGRKGA
KIKKEKKETFEAKISRIAYEVKKENSTIQSSSSSNLRNFKGFKAVESDPVVAAKVSKSET
SRSNPGPSNRNKGKGNKANHKKNSGNGIGKEKERKTNIRNNVRNSQPIPEDRKNTNSHVT
TNSGGKGKNESVDKHQLPQPKALNGNGSGSTNTTGLKKGKKDHAGQKTKGNDKTGNKNPR
EAKLNSAGRKNALGKKSNNQPNKGTSRWTIGSDTESSREPSISPNENTTSITKSRNRNKK
ASKPTLNEKSKTTTMPKKLETKNQEKNNGKTKDGKLIYEEGEPLTRYNTFKSTLSYPDLN
TYLNDYSFALFLEQKLENEFVQNFNILWPRNEKDTAFIINVEKNNNSELEKLLPANLLAL
GRPAFNERQPFFFCTQDEQKVWYIFIKELSIQRGKYVLLVELFSWNNLSLPTKNGSSQFK
LLPTSAQTSRILFAMTRITNPKFIDLLLGQKPIKEIYFDNRLKFSSDKLNRSQKTAVEHV
LNNSITILQGPPGTGKTSTIEEIIIQVIERFHAFPILCVAASNIAIDNIAEKIMENRPQI
KILRILSKKKEQQYSDDHPLGEICLHNIVYKNLSPDMQVVANKTRRGEMISKSEDTKFYK
EKNRVTNKVVSQSQIIFTTNIAAGGRELKVIKECPVVIMDEATQSSEASTLVPLSLPGIR
NFVFVGDEKQLSSFSNIPQLETSLFERVLSNGTYKNPLMLDTQYRMHPKISEFPIKKIYN
GELKDGVTDEQKAWPGVQHPLFFYQCDLGPESRVRSTQRDIVGFTYENKHECVEIVKIIQ
ILMLDKKVPLEEIGVITPYSAQRDLLSDILTKNVVINPKQISMQQEYDEIELFNAAGSQG
TAGSLQNNVINIINGLHVATVDSFQGHEKSFIIFSCVRNNTENKIGFLRDKRRLNVALTR
AKHGLIVVGNKNVLRKGDPLWKDYITYLEEQEVIFTDLTAY
NT seq 3366 nt NT seq  +upstreamnt  +downstreamnt
atggattttcagtgcagaacgtgtagccaggcttatgatgctgagcagatgatgaagcat
ctctcaagtacgaggcataaaactgtattcgacacttcaaatgatgaagatatttgctgt
gaggaatgtcaagataaaaatatacaccaacttcaaatcatcaggtttgggggtgaagac
atggttttactttgtaattcgtgttttcggaaagaatattcagaaacggagcgtccatca
actagctactcattacaaaacggctctatattgaaattttgggaaaagtacgtgaaagtc
agggaatgttgttgtgatgagtgtggggaagagtctaacttgaatgcaaatagaaatgga
gaagtattatgtgacaagtgcttgcccaaatcgaatagagctaaagactttgtttctgaa
aaaagtggaagattcctatacatctacttgggactgaatgaaacacagaatagcactaga
aagcctagaaaaaagggcggcagaagagttggtagaggaaagaagggcaggaagggtgct
aagattaagaaggagaaaaaggaaactttcgaggccaaaataagtagaatcgcttatgaa
gtcaagaaagaaaatagtaccattcaaagctctagtagttccaatctaagaaacttcaaa
ggtttcaaagcggtggaaagcgatccagtagttgcagcaaaagtaagcaaatcagagact
agtagaagtaatcctggcccatcaaatcgaaacaaagggaaaggaaataaggcaaaccac
aaaaagaatagtggaaatgggataggaaaagagaaagagaggaaaacaaacattagaaat
aatgtccgtaacagccaacctataccagaggacagaaaaaataccaatagccacgttaca
acaaactctggagggaaaggcaagaacgaatcagtggataagcaccaattaccgcaacca
aaagctttgaatggaaacgggtcgggcagtactaatactactggtttgaaaaaagggaaa
aaagaccatgctggccagaagactaagggcaatgataaaacgggtaataagaatccgcga
gaggccaaactaaattcagctggcagaaagaatgcacttggcaaaaaatcaaataaccag
ccaaataagggaactagcaggtggacaattggatctgatactgaatcttctagagaacct
agtattagcccaaacgagaacacaacttcaattactaaatcgcgaaaccgcaataagaag
gctagcaagccgacgctgaatgaaaaatcaaaaacaacaacgatgccaaaaaagttggag
acaaaaaatcaagagaaaaataatggaaaaactaaggacgggaaacttatttacgaagaa
ggtgaaccactcacaaggtataatacctttaagtcaaccttatcataccccgatttgaac
acatacctaaatgattactcatttgccctttttttggaacagaaattagagaacgaattt
gttcaaaacttcaacatactatggcctcgcaatgaaaaagatacagcttttataatcaac
gttgagaagaataataattcagaacttgagaaattactacctgcaaatttgcttgcactc
ggtagaccggcatttaatgaaaggcaaccatttttcttttgtactcaggatgaacaaaaa
gtttggtatatttttatcaaagaactttctattcaaaggggtaaatacgtgttgttagtg
gagcttttttcgtggaataatttgagtttgccaacgaaaaatggttcatctcaatttaag
ctattgccaacttctgcgcagacaagtagaattctatttgccatgacgcgtattacaaac
ccaaaatttattgacctattactaggccaaaagcctattaaagagatttattttgataac
aggctaaaattttccagtgacaagttgaaccgatctcagaagactgcagtggaacatgtt
ctaaacaacagtatcacaattctacaaggcccacctggtacaggtaaaacatcaacaata
gaggagataatcatccaagtaattgaaagatttcacgcattcccaatattgtgtgttgcc
gcgtcaaatattgctattgataacattgccgagaagattatggagaatagaccgcagata
aagatcttaagaattttgtcaaagaagaaagaacaacagtatagtgatgaccacccattg
ggcgaaatttgtctccacaatattgtatacaaaaatctttccccagacatgcaagtcgtg
gcaaacaaaacccgcaggggcgaaatgatctccaaatcagaggacacgaagttttataaa
gagaaaaaccgtgtcaccaacaaggtcgtatctcaatcgcaaataattttcacgacaaac
attgctgcaggtggtcgtgaattgaaggttataaaagaatgtcccgtggtaataatggat
gaggctacacaatcatcagaggcttcaacactagtcccactttcgttaccaggtataaga
aattttgtcttcgttggggacgaaaagcaattgtcaagtttcagcaacatccctcaactg
gaaacctcactattcgaaagagtcctatctaatggcacgtacaaaaacccactaatgctg
gatacgcagtacagaatgcacccaaaaattagcgaattccccattaagaaaatatacaat
ggtgaattgaaggacggtgtcacggacgaacaaaaggcatggcctggcgtgcagcatccg
ttgtttttttatcagtgcgatttggggcccgagagcagagtgagaagcacgcaaagagac
atagtcgggtttacgtacgaaaacaaacacgaatgtgtagaaatcgtgaagattatccaa
atactaatgttggacaagaaggttccgctggaagaaattggtgtcataacgccctattct
gcacagcgtgatctgctgtctgacatcttgaccaaaaacgtagttatcaaccccaaacag
atttctatgcaacaagaatacgatgaaattgagctatttaacgcggctggttctcaagga
accgccggcagtctacaaaacaatgtgattaacatcatcaacggcctacacgtcgcgacc
gtagactcctttcaaggccacgaaaaatctttcatcatattttcatgtgtcagaaataac
accgaaaacaaaatcggctttttacgtgacaaaagaaggttaaacgtggcattgacaaga
gccaagcacggactaattgtggtgggcaacaagaatgtcttaagaaaaggagacccccta
tggaaagactacattacctacctcgaggaacaagaggtcatattcactgatctcacagct
tactag

DBGET integrated database retrieval system