KEGG   Saccharomyces cerevisiae (budding yeast): YER177WHelp
Entry
YER177W           CDS       T00005                                 

Gene name
BMH1, APR6
Definition
(RefSeq) 14-3-3 family protein BMH1
  KO
K06630  14-3-3 protein epsilon
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce04011  MAPK signaling pathway - yeast
Brite
KEGG Orthology (KO) [BR:sce00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04011 MAPK signaling pathway - yeast
    YER177W (BMH1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:sce03400]
    YER177W (BMH1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sce04147]
    YER177W (BMH1)
DNA repair and recombination proteins [BR:sce03400]
 Eukaryotic Type
  Check point factors
   Other check point factors
    YER177W (BMH1)
Exosome [BR:sce04147]
 Exosomal proteins
  Proteins found in most exosomes
   YER177W (BMH1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 14-3-3 FlaF
Motif
Other DBs
NCBI-GeneID: 856924
NCBI-ProteinID: NP_011104
SGD: S000000979
UniProt: P29311
Structure
PDB: 

Position
V:545611..546414
Genome map
AA seq 267 aa AA seqDB search
MSTSREDSVYLAKLAEQAERYEEMVENMKTVASSGQELSVEERNLLSVAYKNVIGARRAS
WRIVSSIEQKEESKEKSEHQVELICSYRSKIETELTKISDDILSVLDSHLIPSATTGESK
VFYYKMKGDYHRYLAEFSSGDAREKATNASLEAYKTASEIATTELPPTHPIRLGLALNFS
VFYYEIQNSPDKACHLAKQAFDDAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDMSES
GQAEDQQQQQQHQQQQPPAAAEGEAPK
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaccagtcgtgaagattctgtgtacctagccaagttggctgaacaggccgaacgt
tatgaagaaatggtcgaaaacatgaagactgttgcctcctctggccaagagttgtcggtc
gaagagcgtaatttgttgtctgttgcttataagaacgttattggtgctcgtcgtgcctct
tggagaattgtttcttctattgagcaaaaggaggagtccaaggagaagtccgaacaccag
gtcgagttgatttgttcgtaccgttcgaagattgagaccgaactaactaagatctccgac
gatattttgtccgtgctagactcccacttaattccatcagccaccactggcgagtccaag
gttttctactataagatgaagggtgactaccaccgttatttggctgaattttctagtggc
gatgctagagaaaaggccacaaacgcctctttagaagcatacaagaccgcttctgaaatt
gccaccacagagttacccccaactcacccaatccgtctaggtttggctcttaacttctct
gtcttctattatgaaattcaaaactctccagacaaagcctgccatttggccaagcaagct
tttgacgacgctattgctgagttggacactctgtctgaagaatcatacaaagatagcaca
cttatcatgcaactgctaagggacaatttaaccttatggacttcagacatgtccgagtcc
ggtcaagctgaagaccaacaacaacaacaacaacatcagcaacagcagccacctgctgcc
gccgaaggtgaagcaccaaagtaa

DBGET integrated database retrieval system