KEGG   Saccharomyces cerevisiae (budding yeast): YFL001WHelp
Entry
YFL001W           CDS       T00005                                 

Gene name
DEG1, HRM3, PUS3
Definition
(RefSeq) pseudouridine synthase DEG1
  KO
K01855  tRNA pseudouridine38/39 synthase [EC:5.4.99.45]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Brite
KEGG Orthology (KO) [BR:sce00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:sce03016]
    YFL001W (DEG1)
Enzymes [BR:sce01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.45  tRNA pseudouridine38/39 synthase
     YFL001W (DEG1)
Transfer RNA biogenesis [BR:sce03016]
 Eukaryotic Type
  tRNA modification factors
   Psudouridine synthases
    YFL001W (DEG1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PseudoU_synth_1 Type_ISP_C
Motif
Other DBs
NCBI-GeneID: 850550
NCBI-ProteinID: NP_116655
SGD: S000001895
UniProt: P31115
Position
VI:147131..148459
Genome map
AA seq 442 aa AA seqDB search
MSNFIRRLVGKMKAISTGTNAIVSKKDSIYANWSKEQLIRRITELENANKPHSEKFQHIE
DNKKRKISQEEVTRSKAKKAPKKFDFSKHNTRFIALRFAYLGWNYNGLAVQKEYTPLPTV
EGTILEAMNKCKLVPSMVLQDYKFSRCGRTDKGVSAMNQVISLEVRSNLTDEEQRDPTND
SREIPYVHVLNQLLPDDIRISAVCLRPPPNFDARFSCVHRHYKYIFNGKNLNIEKMSKAA
SYFVGERDFRNFCKLDGSKQITNFKRTIISSKILPLSETFYCFDLVGSAFLWHQVRCMMA
ILFLVGQSLEVPEIVLRLTDIEKTPQRPVYEMANDIPLLLYDCKFPEMDWQEPTVDDYKA
IKFTTATEALTLHYELKAAVCNIFKDVLPTANTNNFSKTIINLGDGRGKVVGTYVKLEDR
SVMEPVEVVNAKYSKKKNNKNK
NT seq 1329 nt NT seq  +upstreamnt  +downstreamnt
atgagtaatttcattagaaggctagttgggaaaatgaaagcgatttcaacaggtaccaat
gctattgttagtaagaaggactccatttacgcaaactggtccaaagagcagctaatacga
aggatcactgaactagaaaacgcaaataagccacattctgaaaaattccagcacatcgag
gataacaaaaagcgcaaaatttcgcaagaagaggttacgagaagcaaggcgaaaaaggct
ccgaagaagtttgacttttctaaacataataccaggttcatcgccttgagatttgcctat
ttgggatggaattacaatggcttagctgttcagaaggaatacacaccgttgcctacagta
gagggtaccattttggaggccatgaataagtgtaaacttgttccctcgatggttttacaa
gactataaatttagcagatgtggcagaacagacaagggagttagcgccatgaaccaagtt
atatcgttagaagtccgttccaatttaacagatgaggaacagcgggatccgaccaacgac
agcagggaaataccctatgttcacgttttaaatcaattactacccgacgatattcgtata
tcagctgtctgcctcagaccgccacctaactttgacgcaagattcagctgtgttcaccgg
cactataagtacatctttaatggaaaaaaccttaatattgaaaaaatgtctaaagccgca
tcatattttgttggagagagagacttcaggaatttttgtaagcttgatggctcaaaacaa
attaccaattttaaacgaacaataataagctcaaaaattcttcccctttctgaaactttc
tattgttttgatctcgttggttcagcattcctatggcaccaagttcgttgcatgatggcc
attcttttcttagttggtcaatcacttgaagtgccggaaattgtcttgcgtctgactgat
attgagaaaacccctcaaaggcctgtttacgaaatggcaaatgatataccattattgtta
tatgattgtaaatttcctgaaatggattggcaagaacctactgtagatgactataaggca
ataaaattcacgacagctactgaagcattgacgttacactacgaacttaaggccgcagta
tgcaatatttttaaagatgttttgcccacagcaaatacaaacaacttctcaaagacaatt
attaatttgggcgatggaagaggtaaagtagtcggtacctatgtgaaactagaggataga
agcgttatggaacctgtcgaagttgttaatgctaaatactccaagaaaaagaacaacaaa
aataagtaa

DBGET integrated database retrieval system